Project name: 1HZH

Status: done

submitted: 2017-11-14 11:18:08, status changed: 2017-11-14 11:39:43
Settings
Chain sequence(s) H: QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
K: QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
M: EIVLTQSPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLERKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC
L: EIVLTQSPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLERKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1555
Maximal score value
1.5605
Average score
-0.8594
Total score value
-1143.8521

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -1.4963
2 V H -1.1203
3 Q H -1.1641
4 L H 0.0000
5 V H 0.6087
6 Q H -0.0237
7 S H -0.7950
8 G H -0.7777
9 A H -0.7773
10 E H -1.6925
11 V H -0.4531
12 K H -2.0004
13 K H -2.5983
14 P H -2.4393
15 G H -2.1754
16 A H -1.8033
17 S H -2.1851
18 V H 0.0000
19 K H -2.4448
20 V H 0.0000
21 S H -0.4813
22 C H 0.0000
23 Q H -0.9300
24 A H 0.0000
25 S H -1.3223
26 G H -1.4424
27 Y H -1.6030
28 R H -2.3928
29 F H 0.0000
30 S H -1.1994
31 N H -1.4959
32 F H 0.0000
33 V H 0.0000
34 I H 0.0000
35 H H 0.0000
36 W H 0.0000
37 V H 0.0000
38 R H 0.0000
39 Q H -0.9391
40 A H -0.8932
41 P H -0.9853
42 G H -1.4621
43 Q H -2.1326
44 R H -1.9039
45 F H 0.0000
46 E H -1.0070
47 W H 0.0000
48 M H 0.0000
49 G H 0.0000
50 W H 0.0000
51 I H 0.0000
52 N H -1.2312
52A P H 0.0000
53 Y H -0.0395
54 N H -1.3216
55 G H -1.4892
56 N H -2.2614
57 K H -2.1595
58 E H -1.7188
59 F H -1.3658
60 S H -1.2791
61 A H -1.5349
62 K H -2.3562
63 F H 0.0000
64 Q H -2.6337
65 D H -2.9917
66 R H -2.4573
67 V H 0.0000
68 T H -1.2648
69 F H 0.0000
70 T H -0.5434
71 A H -0.7664
72 D H -1.0191
73 T H -0.9157
74 S H -0.6891
75 A H -0.8488
76 N H -1.5751
77 T H 0.0000
78 A H 0.0000
79 Y H -0.5570
80 M H 0.0000
81 E H -1.8773
82 L H 0.0000
82A R H -3.0046
82B S H -2.0923
82C L H 0.0000
83 R H -2.8522
84 S H -1.5915
85 A H -0.6396
86 D H 0.0000
87 T H -0.2784
88 A H 0.0000
89 V H 0.0112
90 Y H 0.0000
91 Y H 0.0000
92 C H 0.0000
93 A H 0.0000
94 R H 0.0000
95 V H 0.0000
96 G H 0.0000
97 P H -0.0301
98 Y H 0.2520
99 S H -0.1316
100 W H 0.0525
100A D H -1.7647
100B D H -1.8166
100C S H -1.1554
100D P H -0.9296
100E Q H -0.7908
100F D H -1.3627
100G N H 0.0000
100H Y H 0.0000
100I Y H 0.0000
100J M H 0.0000
101 D H -0.4078
102 V H -0.2152
103 W H 0.0000
104 G H 0.0000
105 K H -1.7885
106 G H -0.8775
107 T H 0.0000
108 T H -0.4029
109 V H 0.0000
110 I H -0.5983
111 V H 0.0000
112 S H -1.2614
113 S H -1.2123
114 A H -0.7905
115 S H -0.7143
116 T H -0.7607
117 K H -1.3454
118 G H -1.3489
119 P H -0.6439
120 S H -0.1717
121 V H 0.0000
122 F H -0.4438
123 P H -1.1177
124 L H 0.0000
125 A H -1.1832
126 P H -1.0738
127 S H -1.3920
128 S H -1.2380
129 K H -1.9630
130 S H -1.3712
133 T H -1.0840
134 S H -0.8885
135 G H -0.8651
136 G H -0.8973
137 T H -0.5855
138 A H -0.5128
139 A H 0.0000
140 L H 0.0000
141 G H 0.0000
142 C H 0.0000
143 L H 0.0000
144 V H 0.0000
145 K H 0.0000
146 D H -0.4305
147 Y H 0.0000
148 F H 0.0000
149 P H 0.0000
150 E H -1.0356
151 P H -0.9353
152 V H -0.6817
153 T H -0.5168
154 V H -0.1811
156 S H -0.4145
157 W H 0.0000
162 N H -0.8025
163 S H -0.7279
164 G H -0.6079
165 A H -0.2861
166 L H -0.0563
167 T H -0.2203
168 S H -0.2262
169 G H -0.2744
171 V H 0.0878
172 H H -0.1180
173 T H 0.0359
174 F H 0.0000
175 P H -0.3765
176 A H 0.0238
177 V H 0.2228
178 L H 0.8619
179 Q H 0.1612
180 S H -0.1041
182 S H -0.2223
183 G H -0.0266
184 L H -0.0030
185 Y H 0.3291
186 S H 0.1062
187 L H 0.0000
188 S H 0.0000
189 S H 0.0000
190 V H 0.0000
191 V H 0.0000
192 T H -0.1368
193 V H 0.0000
194 P H -0.4732
195 S H -0.6222
196 S H -0.5154
197 S H -0.6429
198 L H -0.8029
199 G H -1.0291
200 T H -0.8281
203 Q H -1.4636
205 T H -1.1793
206 Y H 0.0000
207 I H -1.1856
208 C H 0.0000
209 N H -1.4787
210 V H 0.0000
211 N H -1.6557
212 H H 0.0000
213 K H -2.7529
214 P H -1.6846
215 S H -1.9005
216 N H -2.5741
217 T H -2.0405
218 K H -2.5709
219 V H -1.4344
220 D H -2.4682
221 K H -1.9242
222 K H -2.3531
225 A H 0.0000
226 E H -2.9521
227 P H -2.1018
228 K H -2.6052
229 S H -1.8243
230 C H -1.3587
232 D H -2.9989
235 K H -3.3490
236 T H -2.3629
237 H H -2.3919
238 T H -1.4105
239 C H -0.1855
240 P H -0.4159
241 P H 0.0113
242 C H 0.4021
243 P H -0.1256
244 A H -0.9057
245 P H -1.1036
246 E H -1.4119
247 L H 1.1275
248 L H 1.1090
249 G H -0.1047
250 G H -0.5137
251 P H 0.0000
252 S H 0.0606
253 V H 0.0000
254 F H 1.3412
255 L H 1.0799
256 F H 1.2668
257 P H -0.0769
258 P H 0.0000
259 K H -2.2479
260 P H -1.4217
261 K H -1.1312
262 D H 0.0000
263 T H 0.0000
264 L H 0.0000
265 M H 0.2330
266 I H 1.2363
267 S H -0.1495
268 R H -1.6545
269 T H -0.8546
270 P H 0.0000
271 E H -1.2135
272 V H 0.0000
273 T H 0.5127
274 C H 0.0000
275 V H 0.0000
276 V H 0.0000
277 V H -0.8095
278 D H -1.3895
279 V H 0.0000
280 S H -1.7888
281 H H -2.0617
282 E H -2.8674
283 D H -2.4122
284 P H -2.3143
285 E H -2.9242
286 V H -1.8602
287 K H -2.1499
288 F H -1.2085
289 N H -1.3621
290 W H 0.0000
291 Y H -1.1002
292 V H -0.8772
295 D H -1.8873
296 G H -0.8117
299 V H 0.4370
300 E H -1.4002
301 V H -0.9022
302 H H -2.0612
303 N H -2.1955
304 A H -1.6750
305 K H -2.5092
306 T H -2.0883
307 K H -2.8983
308 P H -2.5633
309 R H -3.8088
310 E H -4.1555
311 E H -3.3741
312 Q H -1.9379
313 Y H 0.3303
314 N H -0.5823
317 S H -0.8825
318 T H 0.0000
319 Y H -2.6472
320 R H -3.0849
321 V H 0.0000
322 V H 0.0000
323 S H 0.0000
324 V H -0.8542
325 L H 0.0000
326 T H -0.6747
327 V H 0.0000
328 L H 0.1204
329 H H -0.5919
330 Q H -1.6033
331 D H -1.7264
332 W H 0.0000
333 L H -1.2381
334 N H -2.1514
335 G H -1.9970
336 K H -2.0050
337 E H -2.1749
338 Y H 0.0000
339 K H -1.4881
340 C H 0.0000
341 K H -1.4726
342 V H 0.0000
343 S H -1.3153
344 N H 0.0000
345 K H -2.5145
346 A H -1.6214
347 L H 0.0000
348 P H -1.0465
349 A H -0.6866
350 P H -0.6311
351 I H -0.4060
352 E H -1.4740
353 K H -0.9642
354 T H -0.8417
355 I H -0.1822
357 S H -1.0652
358 K H -1.2944
359 A H -1.0160
360 K H -2.2421
361 G H -1.7994
363 Q H -1.8183
364 P H -1.7480
365 R H -1.8693
366 E H -2.4267
367 P H 0.0000
368 Q H -1.1871
369 V H 0.0000
370 Y H 0.0000
371 T H -0.7919
372 L H 0.0000
373 P H -0.4443
374 P H -0.9396
375 S H -1.5154
376 R H -2.6969
377 D H -2.8246
378 E H 0.0000
381 L H -1.9231
382 T H -1.7295
383 K H -2.3976
384 N H -2.6491
385 Q H -2.5271
386 V H 0.0000
387 S H 0.0000
388 L H 0.0000
389 T H 0.0000
390 C H 0.0000
391 L H 0.0000
392 V H 0.0000
393 K H -0.4871
394 G H -0.9807
395 F H 0.0000
396 Y H -0.9666
397 P H 0.0000
398 S H -0.3439
399 D H -1.1768
400 I H 0.0000
401 A H -0.5471
402 V H -0.2415
405 E H -0.8794
406 W H 0.0000
407 E H -1.5118
408 S H 0.0000
410 N H -1.8176
411 G H -1.8617
414 Q H -2.2996
415 P H -1.9853
416 E H -1.9866
417 N H -2.3520
418 N H -2.0912
419 Y H -1.2641
420 K H -1.0871
421 T H -0.3407
422 T H 0.0000
423 P H -0.1915
424 P H 0.0278
425 V H 0.3376
426 L H 0.3952
427 D H -0.5930
428 S H -1.1560
430 D H -1.8584
433 G H -0.8498
434 S H 0.0000
435 F H 0.0935
436 F H 0.0000
437 L H 0.0000
438 Y H 0.0000
439 S H 0.0000
440 K H 0.0000
441 L H 0.0000
442 T H -1.1439
443 V H 0.0000
444 D H -2.4781
445 K H -2.4748
446 S H -2.0582
447 R H -1.8014
448 W H 0.0000
449 Q H -2.3773
450 Q H -2.3199
451 G H -1.5069
452 N H -0.8287
453 V H 0.7425
454 F H 0.0000
455 S H -0.6099
456 C H 0.0000
457 S H 0.0000
458 V H 0.0000
459 M H 0.0000
460 H H 0.0000
461 E H -1.4806
462 A H -1.6506
463 L H -1.5675
464 H H -1.8816
465 N H -1.8174
466 H H -1.4092
467 Y H -0.6012
468 T H -0.7867
469 Q H -1.1430
470 K H -1.0559
471 S H -0.3593
472 L H 0.0000
473 S H 0.0278
474 L H -0.5851
475 S H -0.7539
476 P H -0.9832
477 G H -1.6494
478 K H -2.5131
1 Q K -1.2293
2 V K -0.6043
3 Q K -0.8373
4 L K 0.0000
5 V K -0.4846
6 Q K -0.7237
7 S K -0.8302
8 G K -0.5780
9 A K -0.1122
10 E K -0.2450
11 V K 0.2513
12 K K -1.3112
13 K K -2.3586
14 P K -2.2525
15 G K -2.0306
16 A K -1.6545
17 S K -2.0026
18 V K 0.0000
19 K K -2.0862
20 V K 0.0000
21 S K -0.6459
22 C K 0.0000
23 Q K -1.3024
24 A K 0.0000
25 S K -1.1454
26 G K -1.1335
27 Y K -1.3650
28 R K -2.2738
29 F K 0.0000
30 S K -1.1656
31 N K -1.4114
32 F K -0.3800
33 V K 0.0000
34 I K 0.0000
35 H K 0.0000
36 W K 0.0000
37 V K 0.0000
38 R K 0.0000
39 Q K -0.8630
40 A K -0.8661
41 P K -0.9615
42 G K -1.4310
43 Q K -2.0707
44 R K -1.7871
45 F K 0.0000
46 E K -0.9471
47 W K 0.0000
48 M K 0.0000
49 G K 0.0000
50 W K -0.4692
51 I K 0.0000
52 N K -1.0850
52A P K 0.0000
53 Y K 0.0036
54 N K -1.4801
55 G K -1.5660
56 N K -2.1184
57 K K -1.7977
58 E K -1.2658
59 F K -0.9571
60 S K -1.1563
61 A K -1.4812
62 K K -2.3207
63 F K 0.0000
64 Q K -2.5374
65 D K -2.9574
66 R K -2.3433
67 V K 0.0000
68 T K -1.1652
69 F K 0.0000
70 T K -0.5324
71 A K -0.5879
72 D K -1.2788
73 T K -0.8814
74 S K -0.7340
75 A K -0.9435
76 N K -1.6191
77 T K 0.0000
78 A K 0.0000
79 Y K -0.5110
80 M K 0.0000
81 E K -1.6639
82 L K 0.0000
82A R K -2.9589
82B S K -2.2046
82C L K 0.0000
83 R K -2.7520
84 S K -1.5172
85 A K -0.6987
86 D K 0.0000
87 T K -0.3508
88 A K 0.0000
89 V K 0.0163
90 Y K 0.0000
91 Y K 0.0000
92 C K 0.0000
93 A K 0.0000
94 R K 0.0000
95 V K 0.0000
96 G K 0.0000
97 P K 0.0262
98 Y K 0.5946
99 S K 0.1185
100 W K 0.2736
100A D K -1.4550
100B D K -1.1760
100C S K -0.9324
100D P K -0.7392
100E Q K -0.7988
100F D K -1.3636
100G N K 0.0000
100H Y K 0.0000
100I Y K 0.0000
100J M K 0.0000
101 D K -0.5893
102 V K -0.2601
103 W K 0.0000
104 G K 0.0000
105 K K -2.0338
106 G K -1.0772
107 T K 0.0000
108 T K -0.0914
109 V K 0.0000
110 I K 0.0000
111 V K 0.0000
112 S K -1.1763
113 S K -1.1303
114 A K -0.8106
115 S K -0.7813
116 T K -0.9053
117 K K -1.6690
118 G K -1.5763
119 P K 0.0000
120 S K -0.4092
121 V K 0.0000
122 F K 0.0000
123 P K -1.2052
124 L K 0.0000
125 A K -1.1413
126 P K 0.0000
127 S K -0.4415
137 T K -0.2390
138 A K -0.1469
139 A K 0.0000
140 L K 0.0000
141 G K 0.0000
142 C K 0.0000
143 L K 0.0000
144 V K 0.0000
145 K K 0.0000
146 D K -0.6063
147 Y K 0.0000
148 F K 0.0000
149 P K 0.0000
150 E K -0.6999
151 P K -0.8002
152 V K -0.6548
153 T K -0.6238
154 V K -0.3723
156 S K -0.4873
157 W K 0.0000
162 N K -0.9667
163 S K -0.7972
164 G K -0.6525
165 A K -0.3203
166 L K -0.0326
167 T K -0.1990
168 S K -0.2055
169 G K -0.2987
171 V K 0.1180
172 H K -0.2131
173 T K -0.0429
174 F K 0.0000
175 P K -0.5097
176 A K 0.0270
177 V K 0.3043
178 L K 1.2762
179 Q K 0.0736
180 S K -0.0268
182 S K -0.2254
183 G K -0.0688
184 L K 0.0000
185 Y K 0.2727
186 S K 0.0000
187 L K 0.0000
188 S K 0.0000
189 S K 0.0000
190 V K 0.0000
191 V K 0.0000
192 T K -0.1787
193 V K 0.0000
194 P K -0.4014
195 S K -0.3802
196 S K -0.5062
197 S K -0.5679
198 L K -0.9297
199 G K -1.3590
200 T K -0.7107
203 Q K -1.2887
205 T K -1.2174
206 Y K 0.0000
207 I K -1.3086
208 C K 0.0000
209 N K -1.5101
210 V K 0.0000
211 N K -1.8535
212 H K 0.0000
213 K K -2.7141
214 P K -1.6763
215 S K -2.0131
216 N K -2.6458
217 T K -2.0405
218 K K -2.5396
219 V K -1.2013
220 D K -2.4632
221 K K -1.9623
222 K K -2.6769
225 A K 0.0000
226 E K -2.7625
227 P K -2.1243
228 K K -2.1311
229 S K -1.6198
230 C K -1.0971
232 D K -2.3996
235 K K -2.7822
239 C K 0.5997
240 P K 0.2123
241 P K 0.1532
242 C K 0.4048
243 P K -0.3896
244 A K -0.4252
245 P K -0.7540
246 E K -0.8214
247 L K 1.3323
248 L K 1.4630
249 G K 0.4374
250 G K -0.0889
251 P K 0.0000
252 S K 0.0386
253 V K 0.0000
254 F K 1.5034
255 L K 1.0900
256 F K 1.4670
257 P K -0.0482
258 P K 0.0000
259 K K -2.1737
260 P K -1.2931
261 K K -1.1528
262 D K -1.3662
263 T K 0.0000
264 L K -0.1787
265 M K 0.5965
266 I K 1.5605
267 S K 0.1987
268 R K -1.1741
269 T K -0.7046
270 P K 0.0000
271 E K -0.9602
272 V K 0.0000
273 T K 0.4369
274 C K 0.0000
275 V K 0.0000
276 V K 0.0000
277 V K -0.7564
278 D K -1.7877
279 V K 0.0000
280 S K -1.1374
281 H K -1.2700
282 E K -1.0875
283 D K 0.0000
284 P K -1.7814
285 E K -2.4648
286 V K -1.6533
287 K K -2.0896
288 F K -1.1618
289 N K -1.1846
290 W K 0.0000
291 Y K -0.7286
292 V K -1.0224
295 D K -2.2930
296 G K -0.9263
299 V K 0.7319
300 E K -0.6088
301 V K -0.5246
302 H K -1.8881
303 N K -2.1808
304 A K -1.7721
305 K K -2.5051
306 T K -1.9536
307 K K -2.7210
308 P K -2.5349
309 R K -3.4920
310 E K -3.6781
311 E K -3.1459
312 Q K -1.6726
313 Y K 0.1542
314 N K -0.7917
317 S K -0.9217
318 T K -1.6956
319 Y K -2.4207
320 R K -2.5861
321 V K 0.0000
322 V K -0.9772
323 S K 0.0000
324 V K 0.0000
325 L K 0.0000
326 T K -0.6520
327 V K 0.0000
328 L K 0.1710
329 H K -0.3270
330 Q K -1.4622
331 D K -1.4080
332 W K 0.0000
333 L K -0.9822
334 N K -2.2102
335 G K -2.3173
336 K K -2.5413
337 E K -2.7450
338 Y K 0.0000
339 K K -1.9083
340 C K 0.0000
341 K K -1.6984
342 V K 0.0000
343 S K -1.2828
344 N K 0.0000
345 K K -2.1186
346 A K -0.8683
347 L K -0.1475
348 P K -0.4223
349 A K -0.5290
350 P K -0.8055
351 I K -0.8232
352 E K -2.1875
353 K K -1.3819
354 T K -1.1573
355 I K -0.4173
357 S K -1.3743
358 K K -1.3647
359 A K -1.1861
360 K K -2.3980
361 G K -2.0734
363 Q K -2.3534
364 P K -2.1815
365 R K -2.7503
366 E K -3.0091
367 P K 0.0000
368 Q K -1.2144
369 V K -0.8150
370 Y K 0.0000
371 T K 0.0000
372 L K 0.0000
373 P K -0.3955
374 P K -0.9165
375 S K -1.5103
376 R K -2.6574
377 D K -2.8265
378 E K 0.0000
381 L K -2.0503
382 T K -1.8716
383 K K -2.6421
384 N K -2.7080
385 Q K -2.5189
386 V K 0.0000
387 S K 0.0000
388 L K 0.0000
389 T K 0.0000
390 C K 0.0000
391 L K 0.0000
392 V K 0.0000
393 K K -0.5576
394 G K -1.1738
395 F K 0.0000
396 Y K -1.3058
397 P K 0.0000
398 S K -0.1695
399 D K -0.8428
400 I K -0.4691
401 A K 0.0000
402 V K 0.0000
405 E K -0.9095
406 W K 0.0000
407 E K -1.7017
408 S K 0.0000
410 N K -1.8479
411 G K -1.8919
414 Q K -2.3414
415 P K -1.9493
416 E K -1.9735
417 N K -2.0543
418 N K -1.3767
419 Y K -0.8542
420 K K -0.7894
421 T K -0.2998
422 T K 0.0000
423 P K -0.1735
424 P K 0.0638
425 V K 0.0000
426 L K 0.7022
427 D K -0.6666
428 S K -1.3192
430 D K -1.9262
433 G K -0.9581
434 S K 0.0000
435 F K 0.0179
436 F K 0.0000
437 L K 0.0000
438 Y K 0.0000
439 S K 0.0000
440 K K 0.0000
441 L K 0.0000
442 T K -0.8508
443 V K 0.0000
444 D K -2.5455
445 K K -2.8948
446 S K -2.6366
447 R K -2.8295
448 W K 0.0000
449 Q K -2.6164
450 Q K -2.4395
451 G K -1.3057
452 N K -0.8877
453 V K 0.5448
454 F K 0.0000
455 S K -0.7280
456 C K 0.0000
457 S K 0.0000
458 V K 0.0000
459 M K -0.3371
460 H K 0.0000
461 E K -1.1449
462 A K -1.8276
463 L K 0.0000
464 H K -1.9439
465 N K -1.8159
466 H K -1.3759
467 Y K -0.3322
468 T K -0.7795
469 Q K -1.2908
470 K K -1.1190
471 S K -0.3816
472 L K 0.0000
473 S K -0.0503
474 L K -0.2014
475 S K -0.1903
1 E L -1.4884
2 I L -0.2525
3 V L 0.6257
4 L L 0.0000
5 T L -0.6891
6 Q L 0.0000
7 S L -0.8956
8 P L -0.5892
9 G L -0.8909
10 T L -0.7898
11 L L -0.4360
12 S L -0.8525
13 L L -1.2875
14 S L -1.6904
15 P L -2.0587
16 G L -2.2782
17 E L -2.9242
18 R L -3.2678
19 A L 0.0000
20 T L -0.5480
21 F L 0.0000
22 S L -1.0242
23 C L 0.0000
24 R L -2.4073
25 S L 0.0000
26 S L -0.9201
27 H L -1.6247
28 S L -1.9206
28A I L 0.0000
29 R L -2.8192
30 S L -2.1220
31 R L -2.8932
32 R L -1.6893
33 V L 0.0000
34 A L 0.0000
35 W L 0.0000
36 Y L 0.0000
37 Q L 0.0000
38 H L -1.0414
39 K L -1.4583
40 P L -1.3244
41 G L -1.6551
42 Q L -2.3470
43 A L -1.8493
44 P L 0.0000
45 R L -1.4553
46 L L 0.0000
47 V L 0.0000
48 I L 0.0000
49 H L -1.2864
50 G L -1.5611
51 V L 0.0000
52 S L -1.4869
53 N L -1.8509
54 R L -2.4534
55 A L 0.0000
56 S L -0.8781
57 G L -0.9377
58 I L -1.2471
59 S L -1.3436
60 D L -2.2585
61 R L -2.1115
62 F L 0.0000
63 S L -1.1527
64 G L 0.0000
65 S L -0.7639
66 G L -1.3812
67 S L -1.8253
68 G L -1.8843
69 T L -1.9227
70 D L -2.3417
71 F L 0.0000
72 T L -0.8406
73 L L 0.0000
74 T L -0.8073
75 I L 0.0000
76 T L -2.3567
77 R L -3.3933
78 V L 0.0000
79 E L -2.5789
80 P L -1.8855
81 E L -2.2296
82 D L 0.0000
83 F L -0.8216
84 A L 0.0000
85 L L -0.2909
86 Y L 0.0000
87 Y L 0.0000
88 C L 0.0000
89 Q L 0.0000
90 V L 0.0000
91 Y L 0.0000
92 G L 0.0000
93 A L -0.3638
94 S L -0.3700
95 S L -0.4337
96 Y L 0.0000
97 T L -0.1820
98 F L 0.0000
99 G L 0.0000
100 Q L -1.0657
101 G L 0.0000
102 T L 0.0000
103 K L -1.0589
104 L L 0.0000
105 E L 0.0000
106 R L -1.4428
107 K L -1.3998
108 R L -0.8267
109 T L 0.2865
110 V L 1.2680
111 A L 0.3415
112 A L -0.1069
113 P L 0.0000
114 S L -0.1885
115 V L 0.0000
116 F L -0.0556
117 I L 0.1515
118 F L 0.0000
119 P L -0.5243
120 P L -0.8293
121 S L -1.5652
122 D L -2.7887
123 E L -2.3232
124 Q L 0.0000
125 L L -1.8536
126 K L -2.5220
127 S L -1.3576
128 G L -1.0506
129 T L -0.7192
130 A L 0.0000
131 S L 0.0000
132 V L 0.0000
133 V L 0.0000
134 C L 0.0000
135 L L 0.0000
136 L L 0.0000
137 N L -0.2929
138 N L -0.7395
139 F L 0.0000
140 Y L 0.0000
141 P L -1.6098
142 R L -3.0361
143 E L -3.2819
144 A L -2.3249
145 K L -2.3678
146 V L -0.9156
147 Q L -0.4875
148 W L 0.0000
149 K L -0.7692
150 V L 0.0000
151 D L -1.9519
152 N L -1.6425
153 A L -0.5198
154 L L 0.3770
155 Q L -0.5037
156 S L -0.7574
157 G L -1.1913
158 N L -1.4025
159 S L -1.4085
160 Q L -1.6357
161 E L -1.9487
162 S L -0.8125
163 V L -0.7048
164 T L -1.0878
165 E L -2.0158
166 Q L -1.9415
167 D L -1.8416
168 S L -1.7120
169 K L -2.1255
170 D L -1.5820
171 S L 0.0000
172 T L 0.0000
173 Y L 0.0000
174 S L 0.0000
175 L L -0.4202
176 S L 0.0000
177 S L 0.0000
178 T L -0.7627
179 L L 0.0000
180 T L -0.5197
181 L L -0.5948
182 S L -0.8596
183 K L -1.8738
184 A L -1.6071
185 D L -2.0213
186 Y L 0.0000
187 E L -3.3895
188 K L -3.4323
189 H L -2.8945
190 K L -2.9951
191 V L -1.1766
192 Y L 0.0000
193 A L 0.0000
194 C L 0.0000
195 E L 0.0000
196 V L 0.0000
197 T L -1.3593
198 H L 0.0000
199 Q L -1.9588
200 G L -0.6221
201 L L -0.9826
202 R L -2.1034
203 S L -1.2230
204 P L -0.9116
205 V L -0.1661
206 T L -0.2815
207 K L -0.6631
208 S L -0.3768
209 F L -0.9285
210 N L -1.8060
211 R L -2.7620
212 G L -2.5178
213 E L -2.4677
214 C L -1.3164
1 E M -1.5198
2 I M -0.2821
3 V M 0.5960
4 L M 0.0000
5 T M -0.7293
6 Q M 0.0000
7 S M -0.8903
8 P M -0.5661
9 G M -0.7758
10 T M -0.4530
11 L M -0.2354
12 S M -0.4387
13 L M -0.7660
14 S M -1.3658
15 P M -1.8827
16 G M -2.0740
17 E M -2.6888
18 R M -3.0045
19 A M 0.0000
20 T M -0.5649
21 F M 0.0000
22 S M -0.9904
23 C M 0.0000
24 R M -2.3124
25 S M 0.0000
26 S M -1.0295
27 H M -1.7716
28 S M -2.0187
28A I M 0.0000
29 R M -2.8713
30 S M -2.1821
31 R M -2.9151
32 R M -1.7484
33 V M 0.0000
34 A M 0.0000
35 W M 0.0000
36 Y M 0.0000
37 Q M 0.0000
38 H M 0.0000
39 K M -1.3949
40 P M -1.2657
41 G M -1.5814
42 Q M -2.3640
43 A M -1.9467
44 P M 0.0000
45 R M -2.0279
46 L M 0.0000
47 V M 0.0000
48 I M 0.0000
49 H M -1.3039
50 G M -1.5077
51 V M 0.0000
52 S M -1.5085
53 N M -1.9919
54 R M -2.1645
55 A M 0.0000
56 S M -0.8211
57 G M -0.8495
58 I M -1.0406
59 S M -1.2273
60 D M -2.1415
61 R M -2.0094
62 F M 0.0000
63 S M -1.0786
64 G M -0.8010
65 S M -0.7862
66 G M -1.2804
67 S M -1.6270
68 G M -1.9966
69 T M -2.0889
70 D M -2.1669
71 F M 0.0000
72 T M -0.7785
73 L M 0.0000
74 T M -0.7820
75 I M 0.0000
76 T M -2.2484
77 R M -3.1691
78 V M 0.0000
79 E M -2.2020
80 P M -1.6157
81 E M -2.2377
82 D M 0.0000
83 F M -0.6691
84 A M 0.0000
85 L M -0.1019
86 Y M 0.0000
87 Y M 0.0000
88 C M 0.0000
89 Q M 0.0000
90 V M 0.0000
91 Y M 0.0000
92 G M 0.0000
93 A M -0.3319
94 S M -0.2380
95 S M -0.3912
96 Y M 0.0000
97 T M -0.1412
98 F M 0.0000
99 G M 0.0000
100 Q M -0.9426
101 G M 0.0000
102 T M 0.0000
103 K M -0.5314
104 L M 0.0000
105 E M 0.0000
106 R M -0.9979
107 K M -0.6605
108 R M 0.0000
109 T M 0.1845
110 V M 1.0576
111 A M 0.3156
112 A M 0.0871
113 P M 0.0000
114 S M -0.2723
115 V M 0.0000
116 F M -0.0977
117 I M 0.0000
118 F M 0.0000
119 P M -0.8339
120 P M 0.0000
121 S M -1.4389
122 D M -2.7815
123 E M -2.5189
124 Q M 0.0000
125 L M -2.1468
126 K M -2.7055
127 S M -1.7650
128 G M -1.2689
129 T M -1.1072
130 A M 0.0000
131 S M 0.0000
132 V M 0.0000
133 V M 0.0000
134 C M 0.0000
135 L M 0.0000
136 L M 0.0000
137 N M 0.0000
138 N M -1.1324
139 F M 0.0000
140 Y M 0.0000
141 P M -1.3810
142 R M -2.6878
143 E M -3.0014
144 A M -2.2617
145 K M -2.4730
146 V M -1.2336
147 Q M -0.8323
148 W M 0.0000
149 K M -1.0289
150 V M 0.0000
151 D M -1.9999
152 N M -1.6288
153 A M -0.3510
154 L M 0.7157
155 Q M -0.4616
156 S M -0.7263
157 G M -1.3476
158 N M -1.6865
159 S M -1.7852
160 Q M -2.1381
161 E M -2.4365
162 S M -0.9964
163 V M -0.9964
164 T M -1.1892
165 E M -2.2683
166 Q M -2.1020
167 D M -2.2401
168 S M -2.1102
169 K M -2.6471
170 D M -2.3975
171 S M 0.0000
172 T M 0.0000
173 Y M 0.0000
174 S M 0.0000
175 L M 0.0000
176 S M 0.0000
177 S M 0.0000
178 T M 0.0000
179 L M 0.0000
180 T M -0.6356
181 L M -0.9043
182 S M -1.3939
183 K M -2.4765
184 A M -1.9770
185 D M -3.0571
186 Y M 0.0000
187 E M -3.4164
188 K M -3.6448
189 H M -3.2678
190 K M -3.1826
191 V M -2.0631
192 Y M 0.0000
193 A M -1.0812
194 C M 0.0000
195 E M -1.1710
196 V M 0.0000
197 T M -1.4939
198 H M 0.0000
199 Q M -1.9151
200 G M -0.6467
201 L M -0.7366
202 R M -2.0424
203 S M -1.2007
204 P M -0.9227
205 V M -0.2359
206 T M -0.7093
207 K M -1.0447
208 S M -0.9336
209 F M -0.9017
210 N M -2.1128
211 R M -2.3259
212 G M -2.1157
213 E M -2.1112
214 C M -0.8384

 

Laboratory of Theory of Biopolymers 2015