Project name: f8713b7832664fa

Status: done

submitted: 2017-03-17 08:47:34, status changed: 2017-03-17 08:53:28
Settings
Chain sequence(s) A: DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP
P: VVQEALDKAREGR
B: EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARRELYSYYSPLDVWGAGTTVTVPS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7546
Maximal score value
1.3344
Average score
-0.7093
Total score value
-174.4844

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.4999
2 I A 0.0000
3 V A 0.8801
4 M A 0.0000
5 T A -0.2966
6 Q A 0.0000
7 S A -0.6090
8 P A -0.4742
9 S A -0.5716
10 S A -0.8281
11 L A -0.4910
12 T A -0.5714
13 V A 0.0000
14 T A -0.7785
15 A A -0.9977
16 G A -1.3355
17 E A -1.7939
18 K A -2.2590
19 V A 0.0000
20 T A -0.4692
21 M A 0.0000
22 S A -0.8223
23 C A 0.0000
24 K A -1.9327
25 S A 0.0000
26 S A -0.9517
27 Q A -1.5754
28 S A -1.1306
29 L A 0.0000
30 L A -0.7394
31 N A -0.8558
32 S A -1.1203
33 G A -1.3564
34 N A -1.4387
35 Q A -1.9569
36 K A -1.6145
37 N A -0.7930
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 K A -1.4731
46 P A -1.0094
47 G A -1.2256
48 Q A -1.7181
49 P A -0.9890
50 P A 0.0000
51 K A -1.2514
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -0.2184
56 W A -0.3057
57 A A 0.0000
58 S A -0.6126
59 T A -0.6232
60 R A -1.5631
61 E A -1.1675
62 S A -0.8776
63 G A -0.9995
64 V A -1.0921
65 P A -1.3172
66 D A -2.1811
67 R A -1.5114
68 F A 0.0000
69 T A -0.8078
70 G A 0.0000
71 S A -0.6067
72 G A -1.1180
73 S A -1.2268
74 G A -1.2719
75 T A -1.6744
76 D A -2.3552
77 F A 0.0000
78 T A -0.7593
79 L A 0.0000
80 T A -0.5260
81 I A 0.0000
82 S A -1.5445
83 S A -1.5914
84 V A 0.0000
85 Q A -1.2258
86 A A -1.0021
87 E A -1.8474
88 D A 0.0000
89 L A -0.7330
90 A A 0.0000
91 V A -0.4536
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.1075
99 S A 0.1229
100 Y A 0.0651
101 P A -0.4922
102 L A 0.0000
103 T A 0.0622
104 F A 0.3234
105 G A 0.0000
106 A A -0.0350
107 G A 0.0000
108 T A 0.0000
109 K A -1.2610
110 L A 0.0000
111 E A -1.3412
112 P A -0.7781
1 E B -1.8178
2 V B -0.7773
3 Q B -1.5109
4 L B 0.0000
5 Q B -1.6405
6 Q B -1.0074
7 S B -0.9471
8 G B -0.6819
9 A B -0.1530
10 E B -0.4007
11 L B 0.8259
12 V B -0.2744
13 R B -1.7552
14 P B -1.3412
15 G B -1.0758
16 A B -0.8649
17 S B -1.0936
18 V B 0.0000
19 K B -1.9409
20 L B 0.0000
21 S B -0.6687
22 C B 0.0000
23 T B -0.9283
24 A B 0.0000
25 S B -1.0393
26 G B -1.0008
27 F B -0.8323
28 N B -1.2649
29 I B 0.0000
30 K B -2.2344
31 D B -1.1475
32 D B 0.0000
33 F B 0.0000
34 M B 0.0000
35 H B 0.0000
36 W B 0.0000
37 V B 0.0000
38 K B 0.0000
39 Q B -1.1143
40 R B -1.8497
41 P B -1.6575
42 E B -2.5006
43 Q B -2.0812
44 G B -1.1532
45 L B 0.0000
46 E B -1.1295
47 W B 0.0000
48 I B 0.0000
49 G B 0.0000
50 R B 0.0000
51 I B 0.0000
52 D B 0.0000
53 P B 0.0000
54 A B -2.0275
55 N B -2.7563
56 D B -3.1158
57 N B -2.5635
58 T B -1.4266
59 K B -1.1982
60 Y B -0.9727
61 A B 0.0000
62 P B -1.7306
63 K B -2.5824
64 F B 0.0000
65 Q B -2.7433
66 D B -2.9024
67 K B -1.9965
68 A B 0.0000
69 T B -0.7910
70 I B 0.0000
71 I B 0.1072
72 A B -0.5864
73 D B -1.0982
74 T B -0.9836
75 S B -0.8472
76 S B -0.7196
77 N B -0.9330
78 T B 0.0000
79 A B 0.0000
80 Y B -0.1517
81 L B 0.0000
82 Q B -1.2167
83 L B 0.0000
84 S B -1.1241
85 S B -0.9857
86 L B 0.0000
87 T B -1.2455
88 S B -1.3882
89 E B -2.0232
90 D B 0.0000
91 T B -0.7063
92 A B 0.0000
93 V B 0.0551
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B -0.4253
99 R B 0.0000
100 E B -0.1525
101 L B 0.3029
102 Y B 1.3344
103 S B 1.0638
104 Y B 1.1545
105 Y B 0.0000
106 S B 0.0000
107 P B 0.0000
108 L B 0.0000
109 D B -0.5432
110 V B -0.2718
111 W B -0.5340
112 G B 0.0000
113 A B -0.6699
114 G B -0.4916
115 T B 0.0000
116 T B -0.0434
117 V B 0.0000
118 T B -0.1314
119 V B 0.0000
120 P B -0.6871
121 S B -0.8216
1 V P 0.5695
2 V P 0.0000
3 Q P 0.0000
4 E P -2.0226
5 A P -1.7090
6 L P 0.0000
7 D P -2.7799
8 K P -3.7546
9 A P -2.9650
10 R P -2.6173
11 E P -3.6420
12 G P -3.0642
13 R P -3.3808

 

Laboratory of Theory of Biopolymers 2015