Project name: 426cTM4

Status: done

submitted: 2018-07-10 22:15:46, status changed: 2018-07-13 15:38:45
Settings
Chain sequence(s) A: EAKTTLFCASDAKAYEKECHNVWATHACVPTDPNPQEVVLEQVTENFNMWKNDMVDQMQEDVISIWDQCLKPCVKLTNTSTLTQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLRDNAKIIIVQLQKSVEIVCTRPNNGDIRQAYCQISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFQDTISNATIMLPCRIKQIINMWQEVGKAIYAPPIKGQITCKSDITGLLLLRDGGDTTDNTEIFRPSGGDMRDNWRSELYKYKVVEIK
B: EAKTTLFCASDAKAYEKECHNVWATHACVPTDPNPQEVVLEQVTENFNMWKNDMVDQMQEDVISIWDQCLKPCVKLTNTSTLTQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLRDNAKIIIVQLQKSVEIVCTRPNNGGDIRQAYCQISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFQDTISNATIMLPCRIKQIINMWQEVGKAIYAPPIKGQITCKSDITGLLLLRDGGDTTDNTEIFRPSGGDMRDNWRSELYKYKVVEI
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1307
Maximal score value
1.6821
Average score
-0.7724
Total score value
-519.0271

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
47 E A -2.3430
48 A A -1.7457
49 K A -2.3073
50 T A -1.1316
51 T A -0.2579
52 L A 0.0000
53 F A 1.1560
54 C A 0.0000
55 A A 0.0000
56 S A 0.0000
57 D A -1.9672
58 A A -0.9824
59 K A -1.1083
60 A A -0.3231
61 Y A 0.4777
62 E A -0.9056
63 K A -1.5514
64 E A 0.0000
65 C A 0.0000
66 H A 0.0000
67 N A 0.0000
68 V A -0.1828
69 W A -0.4533
70 A A 0.0000
71 T A -0.3706
72 H A -0.5839
73 A A 0.0348
74 C A 0.0000
75 V A 0.8590
76 P A -0.4224
77 T A -1.0300
78 D A -1.6233
79 P A -1.6013
80 N A -2.1739
81 P A -2.2339
82 Q A -2.1652
83 E A -1.0612
84 V A 1.4352
85 V A 1.6821
86 L A 0.2079
87 E A -1.7132
88 Q A -2.0155
89 V A -1.1380
90 T A -1.5786
91 E A -1.4916
92 N A -1.8572
93 F A 0.0000
94 N A -1.4789
95 M A 0.0000
96 W A -1.3152
97 K A -2.2626
98 N A -1.8231
99 D A -1.9249
100 M A 0.0000
101 V A 0.0000
102 D A -2.6711
103 Q A -1.7519
104 M A 0.0000
105 Q A -2.0166
106 E A -2.4764
107 D A -1.5939
108 V A 0.0000
109 I A -1.2114
110 S A -1.3237
111 I A 0.0000
112 W A 0.0000
113 D A -2.2457
114 Q A -1.4910
115 C A 0.0000
116 L A 0.0000
117 K A -1.2792
118 P A 0.0000
119 C A 0.1750
120 V A 0.5198
121 K A -0.0013
122 L A 0.0749
123 T A -0.6012
124 N A -1.0979
198 T A -0.7175
199 S A -0.4329
200 T A -0.0691
201 L A 0.4786
202 T A 0.2305
203 Q A -0.2837
204 A A -0.2524
205 C A -0.2769
206 P A -0.5778
207 K A -0.6757
208 V A -0.5404
209 T A -0.9252
210 F A 0.0000
211 D A -1.8303
212 P A -1.0511
213 I A -0.7739
214 P A -0.7288
215 I A 0.0000
216 H A -0.4918
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 P A -0.0255
221 A A 0.0355
222 G A -0.0997
223 Y A -0.3367
224 A A -0.1495
225 I A 0.0000
226 L A 0.0000
227 K A -0.4882
228 C A 0.0000
229 N A -1.4922
230 N A -2.5925
231 K A -3.4672
232 T A -2.2126
233 F A 0.0000
234 N A -1.1947
235 G A 0.0000
236 K A -1.4550
237 G A 0.0000
238 P A -1.6087
239 C A 0.0000
240 N A -2.6794
241 N A -2.4322
242 V A 0.0000
243 S A 0.0000
244 T A 0.3861
245 V A -0.5268
246 Q A -1.1752
247 C A -0.7750
248 T A 0.0000
249 H A -0.6459
250 G A -0.7210
251 I A 0.0000
252 K A -0.9400
253 P A 0.0000
254 V A -0.3310
255 V A 0.0000
256 S A 0.0000
257 T A 0.0000
258 Q A 0.0000
259 L A 0.0000
260 L A 0.0000
261 L A 0.0000
262 N A -1.2935
263 G A -0.6014
264 S A -0.5854
265 L A -0.9338
266 A A 0.0000
267 E A -3.7853
268 E A -4.1307
269 E A -3.6732
270 I A 0.0000
271 V A 0.0000
272 I A 0.0000
273 R A 0.0000
274 S A -0.8554
275 K A -1.4608
276 N A -1.2263
277 L A -0.8807
278 R A -1.6847
279 D A 0.0000
280 N A -1.3054
281 A A -0.7400
282 K A -1.0081
283 I A -0.3085
284 I A 0.0000
285 I A 0.0000
286 V A 0.0000
287 Q A 0.0000
288 L A 0.0000
289 Q A -2.5059
290 K A -2.8861
291 S A -1.5862
292 V A 0.0000
293 E A -2.1486
294 I A 0.0000
295 V A -0.8702
296 C A 0.0000
297 T A 0.0000
298 R A 0.0000
299 P A -1.9671
300 N A -2.7379
301 N A -2.6723
324 G A -1.6396
325 D A -1.9083
326 I A -1.3009
327 R A -1.5325
328 Q A -1.5353
329 A A 0.0000
330 Y A -0.0205
331 C A 0.0000
332 Q A -0.4395
333 I A 0.0000
334 S A -1.3950
335 G A 0.0000
336 R A -3.1220
337 N A -2.6583
338 W A 0.0000
339 S A -2.6285
340 E A -3.4498
341 A A -2.5288
342 V A 0.0000
343 N A -3.0353
344 Q A -3.1381
345 V A 0.0000
346 K A -2.5888
347 K A -3.2670
348 K A -2.3862
349 L A 0.0000
350 K A -2.8036
351 E A -2.4115
352 H A -1.6579
353 F A 0.0000
354 P A -1.7311
355 H A -2.1292
356 K A -2.4594
357 N A -2.6163
358 I A 0.0000
359 S A 0.0000
360 F A 0.0000
361 Q A -1.0655
362 S A -0.7513
363 S A -0.3954
364 S A -0.6938
365 G A -0.9165
366 G A -1.1155
367 D A -1.2650
368 L A -0.1262
369 E A -0.2066
370 I A -0.2556
371 T A -0.4515
372 T A 0.0000
373 H A 0.0000
374 S A 0.0000
375 F A 0.0000
376 N A -0.3753
377 C A 0.0000
378 G A -0.6574
379 G A -0.4253
380 E A 0.0000
381 F A 0.0000
382 F A 0.0000
383 Y A 0.0000
384 C A 0.0000
385 N A -0.8490
386 T A 0.0000
387 S A -0.7756
388 G A -0.6781
389 L A 0.0000
390 F A 0.0000
391 Q A -1.6562
392 D A -2.2600
393 T A -1.1912
394 I A -1.2602
395 S A -1.2884
396 N A -2.4708
412 A A -0.9920
413 T A -0.5514
414 I A 0.0007
415 M A 0.8011
416 L A 0.0000
417 P A -0.4534
418 C A 0.0000
419 R A -1.6881
420 I A 0.0000
421 K A -0.6454
422 Q A 0.1079
423 I A 1.1395
424 I A 0.0000
425 N A -0.3080
426 M A -0.2584
427 W A -0.6110
428 Q A -1.2035
429 E A -1.1703
430 V A 0.4386
431 G A -0.5122
432 K A -0.5651
433 A A 0.0000
434 I A 0.7573
435 Y A 0.2428
436 A A 0.2009
437 P A -0.1513
438 P A -0.2543
439 I A -0.1919
440 K A -1.9542
441 G A -2.0898
442 Q A -2.2841
443 I A 0.0000
444 T A -0.6394
445 C A -0.9885
446 K A -2.0929
447 S A 0.0000
448 D A -2.2853
449 I A 0.0000
450 T A 0.0000
451 G A 0.0000
452 L A 0.0000
453 L A 0.0000
454 L A 0.0000
455 L A 0.0803
456 R A -0.6399
457 D A -1.0597
458 G A -1.5000
459 G A -1.9465
460 D A -2.6240
461 T A -2.1909
462 T A -1.9537
463 D A -2.9333
464 N A -3.0037
465 T A -2.1771
466 E A 0.0000
467 I A -0.3160
468 F A 0.0000
469 R A -0.4125
470 P A 0.0000
471 S A 0.0000
472 G A -0.2918
473 G A -0.8066
474 D A -1.1174
475 M A 0.0000
476 R A -1.7585
477 D A -0.8232
478 N A 0.0000
479 W A 0.0000
480 R A 0.0000
481 S A -0.1947
482 E A 0.0000
483 L A 0.0000
484 Y A 0.0000
485 K A -0.8904
486 Y A 0.0000
487 K A -1.1922
488 V A -0.8000
489 V A -1.0198
490 E A -1.2193
491 I A 0.4344
492 K A -1.2485
47 E B -2.3298
48 A B -1.9125
49 K B -2.3830
50 T B -1.2593
51 T B -0.2797
52 L B 0.0000
53 F B 1.0573
54 C B 0.0000
55 A B 0.0000
56 S B 0.0000
57 D B -2.0519
58 A B -1.2639
59 K B -1.6511
60 A B -0.5962
61 Y B 0.3243
62 E B -1.0424
63 K B -1.6298
64 E B 0.0000
65 C B 0.0000
66 H B 0.0000
67 N B 0.0000
68 V B -0.3856
69 W B 0.0000
70 A B 0.0000
71 T B -0.5429
72 H B -0.6317
73 A B -0.0137
74 C B 0.0000
75 V B 0.9055
76 P B -0.4213
77 T B -0.9286
78 D B -1.4650
79 P B -1.3327
80 N B -1.9589
81 P B -2.2690
82 Q B -2.2800
83 E B -1.1689
84 V B 1.2794
85 V B 1.5740
86 L B 0.1665
87 E B -1.7119
88 Q B -1.9857
89 V B -1.1324
90 T B -1.5353
91 E B -1.6095
92 N B -1.7876
93 F B 0.0000
94 N B -1.6417
95 M B 0.0000
96 W B 0.0000
97 K B -2.3561
98 N B -1.8625
99 D B -1.8913
100 M B 0.0000
101 V B 0.0000
102 D B -2.5873
103 Q B -1.7085
104 M B 0.0000
105 Q B -1.9556
106 E B -2.4388
107 D B -1.5901
108 V B 0.0000
109 I B -1.2022
110 S B -1.3343
111 I B 0.0000
112 W B 0.0000
113 D B -2.2722
114 Q B -1.5366
115 C B 0.0000
116 L B 0.0000
117 K B -1.3389
118 P B 0.0000
119 C B 0.1355
120 V B 0.4676
121 K B -0.0816
122 L B -0.0047
123 T B -0.6408
124 N B -1.0984
198 T B -0.7479
199 S B -0.4575
200 T B -0.1022
201 L B 0.4468
202 T B 0.2052
203 Q B -0.2939
204 A B -0.2624
205 C B -0.3024
206 P B -0.5742
207 K B -0.6477
208 V B -0.6309
209 T B -0.9172
210 F B 0.0000
211 D B -1.8343
212 P B -1.0655
213 I B -0.7901
214 P B -0.7768
215 I B 0.0000
216 H B -0.5418
217 Y B 0.0000
218 C B 0.0000
219 A B 0.0000
220 P B -0.2134
221 A B -0.1727
222 G B -0.1107
223 Y B -0.4941
224 A B -0.2774
225 I B 0.0000
226 L B 0.0000
227 K B -0.4916
228 C B 0.0000
229 N B -1.4341
230 N B -2.3541
231 K B -3.3217
232 T B -2.0630
233 F B 0.0000
234 N B -1.2200
235 G B 0.0000
236 K B -1.5584
237 G B 0.0000
238 P B -1.6063
239 C B 0.0000
240 N B -2.5296
241 N B -2.2518
242 V B 0.0000
243 S B 0.0000
244 T B 0.2832
245 V B -0.7479
246 Q B -1.4791
247 C B -0.9432
248 T B 0.0000
249 H B -0.7359
250 G B -0.8001
251 I B 0.0000
252 K B -1.0313
253 P B 0.0000
254 V B -0.3517
255 V B 0.0000
256 S B 0.0000
257 T B 0.0000
258 Q B 0.0000
259 L B 0.0000
260 L B 0.0000
261 L B 0.0000
262 N B -1.3549
263 G B -0.7109
264 S B -0.5921
265 L B -0.7516
266 A B 0.0000
267 E B -3.5442
268 E B -3.7312
269 E B -2.9598
270 I B 0.0000
271 V B 0.0000
272 I B 0.0000
273 R B 0.0000
274 S B -0.8407
275 K B -1.4735
276 N B -1.1999
277 L B -0.8374
278 R B -1.6543
279 D B 0.0000
280 N B -1.2566
281 A B -0.6870
282 K B -0.9054
283 I B -0.2485
284 I B 0.0000
285 I B 0.0000
286 V B 0.0000
287 Q B 0.0000
288 L B 0.0000
289 Q B -2.0416
290 K B -2.2124
291 S B -1.3149
292 V B 0.0000
293 E B -2.0788
294 I B 0.0000
295 V B -0.8850
296 C B 0.0000
297 T B 0.0000
298 R B 0.0000
299 P B -2.0355
300 N B -2.8339
301 N B -2.8354
323 G B -1.8911
324 G B -1.8157
325 D B -2.1147
326 I B -1.5395
327 R B -1.4439
328 Q B -1.5684
329 A B 0.0000
330 Y B 0.0618
331 C B 0.0000
332 Q B -0.3337
333 I B 0.0000
334 S B -1.2892
335 G B 0.0000
336 R B -2.9025
337 N B -2.2932
338 W B 0.0000
339 S B -2.2557
340 E B -2.6253
341 A B 0.0000
342 V B 0.0000
343 N B -2.5978
344 Q B -2.6218
345 V B 0.0000
346 K B -2.3392
347 K B -3.1003
348 K B -2.2030
349 L B 0.0000
350 K B -2.7163
351 E B -2.4640
352 H B -1.6516
353 F B 0.0000
354 P B -1.8328
355 H B -2.1537
356 K B -2.5629
357 N B -2.6602
358 I B 0.0000
359 S B 0.0000
360 F B 0.0000
361 Q B -1.1667
362 S B -0.8175
363 S B -0.4286
364 S B -0.7219
365 G B -0.9191
366 G B -1.1380
367 D B -1.3225
368 L B -0.1697
369 E B -0.2087
370 I B -0.2245
371 T B -0.4547
372 T B 0.0000
373 H B 0.0000
374 S B 0.0000
375 F B 0.0000
376 N B -0.3831
377 C B 0.0000
378 G B -0.6490
379 G B -0.4140
380 E B 0.0000
381 F B 0.0000
382 F B 0.0000
383 Y B 0.0000
384 C B 0.0000
385 N B -0.7892
386 T B 0.0000
387 S B -0.7367
388 G B -0.5209
389 L B 0.0000
390 F B 0.0000
391 Q B -1.6683
392 D B -2.2166
393 T B -1.1488
394 I B -1.1647
395 S B -1.3215
396 N B -2.3197
412 A B -0.9747
413 T B -0.5410
414 I B 0.0657
415 M B 0.8422
416 L B 0.0000
417 P B -0.4451
418 C B 0.0000
419 R B -1.6576
420 I B 0.0000
421 K B -0.5725
422 Q B 0.1166
423 I B 1.1209
424 I B 0.0000
425 N B -0.3284
426 M B -0.2288
427 W B -0.5828
428 Q B -1.2021
429 E B -1.1567
430 V B 0.4425
431 G B -0.4845
432 K B -0.5530
433 A B 0.0000
434 I B 0.6704
435 Y B 0.1838
436 A B 0.1157
437 P B -0.1846
438 P B 0.0000
439 I B -0.2157
440 K B -1.9809
441 G B -2.1252
442 Q B -2.2678
443 I B 0.0000
444 T B -0.6389
445 C B -1.0049
446 K B -2.1179
447 S B -1.8442
448 D B -2.3082
449 I B 0.0000
450 T B 0.0000
451 G B 0.0000
452 L B 0.0000
453 L B 0.0000
454 L B 0.0000
455 L B 0.0944
456 R B -0.6758
457 D B -1.1615
458 G B -1.6562
459 G B -1.9740
460 D B -2.6417
461 T B -2.3546
462 T B -1.8698
463 D B -2.9553
464 N B -3.0607
465 T B -2.2736
466 E B 0.0000
467 I B -0.4067
468 F B 0.0000
469 R B -0.5033
470 P B 0.0000
471 S B 0.0000
472 G B -0.2590
473 G B -0.7947
474 D B -1.1088
475 M B 0.0000
476 R B -1.6673
477 D B -0.8464
478 N B 0.0000
479 W B 0.0000
480 R B -0.9171
481 S B -0.2853
482 E B 0.0000
483 L B 0.0000
484 Y B 0.0000
485 K B -0.9640
486 Y B 0.0000
487 K B 0.0000
488 V B -0.9112
489 V B -1.1379
490 E B -1.3476
491 I B 0.9796

 

Laboratory of Theory of Biopolymers 2015