Project name: test9

Status: done

submitted: 2019-02-12 14:52:52, status changed: 2019-02-12 14:57:37
Settings
Chain sequence(s) A: GGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFREN
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.4378
Maximal score value
2.3648
Average score
-0.4347
Total score value
-34.344

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.5546
2 G A -0.5947
3 S A 0.0314
4 V A 1.5075
5 Q A -0.4878
6 I A 2.1176
7 V A 2.3648
8 Y A 1.2041
9 K A -1.5228
10 P A -0.1806
11 V A 1.4018
12 D A -1.1658
13 L A 1.1683
14 S A -0.2453
15 K A -1.4952
16 V A 0.9621
17 T A 0.1346
18 S A -0.5300
19 K A -1.6007
20 C A 0.3278
21 G A -0.3691
22 S A -0.0121
23 L A 1.4217
24 G A -0.4194
25 N A -1.1591
26 I A 0.6351
27 H A -0.9557
28 H A -1.4039
29 K A -1.9163
30 P A -0.6589
31 G A -0.5994
32 G A -0.6365
33 G A -0.7613
34 Q A -1.0782
35 V A 0.5288
36 E A -1.4314
37 V A 0.3230
38 K A -1.5550
39 S A -0.8626
40 E A -2.1769
41 K A -1.7464
42 L A 0.8876
43 D A -1.1504
44 F A 1.1749
45 K A -1.6841
46 D A -2.4378
47 R A -1.9989
48 V A 0.3456
49 Q A -1.0495
50 S A -0.6587
51 K A -1.4715
52 I A 0.9109
53 G A -0.2194
54 S A -0.0063
55 L A 1.1759
56 D A -1.7409
57 N A -1.2336
58 I A 1.7617
59 T A 0.1187
60 H A -0.8814
61 V A 0.4271
62 P A -0.1055
63 G A -0.5810
64 G A -0.6415
65 G A -0.6945
66 N A -1.1756
67 K A -2.1679
68 K A -1.6438
69 I A 1.3547
70 E A -1.4586
71 T A -0.5962
72 H A -1.3241
73 K A -1.6978
74 L A 0.6820
75 T A 0.3912
76 F A 0.9899
77 R A -1.9325
78 E A -2.4067
79 N A -1.6149

 

Laboratory of Theory of Biopolymers 2015