Project name: test

Status: done

submitted: 2019-09-23 14:06:02, status changed: 2019-09-23 21:31:23
Settings
Chain sequence(s) A: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.2558
Maximal score value
1.609
Average score
-0.5677
Total score value
-31.7931

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0465
2 T A -0.0883
3 Y A 0.0000
4 K A -0.9169
5 L A 0.0000
6 I A 0.1442
7 L A 0.0000
8 N A -0.5503
9 G A 0.0000
10 K A -1.7131
11 T A -0.2429
12 L A 0.4541
13 K A -1.6244
14 G A -0.8032
15 E A -1.7996
16 T A -0.3827
17 T A -0.2057
18 T A 0.0000
19 E A -1.8249
20 A A 0.0000
21 V A 1.6090
22 D A -0.5661
23 A A -0.1288
24 A A 0.0540
25 T A -0.0374
26 A A 0.0000
27 E A -1.8182
28 K A -1.9989
29 V A -0.0127
30 F A 0.0000
31 K A -1.0589
32 Q A -0.9261
33 Y A 0.5622
34 A A 0.0000
35 N A -1.6512
36 D A -2.2558
37 N A -1.6855
38 G A -0.8350
39 V A 0.0000
40 D A -1.8751
41 G A -1.3409
42 E A -1.8661
43 W A -0.1243
44 T A 0.0870
45 Y A 0.2671
46 D A -1.0952
47 D A -2.0563
48 A A -0.2829
49 T A -0.2747
50 K A -1.3716
51 T A -0.3611
52 F A 0.0000
53 T A 0.0380
54 V A 0.0000
55 T A -0.4021
56 E A -1.8783

 

Laboratory of Theory of Biopolymers 2015