Project name: Model1rataggr

Status: done

submitted: 2017-03-14 16:13:27, status changed: 2017-03-14 16:21:55
Settings
Chain sequence(s) A: PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.3872
Maximal score value
1.7916
Average score
-0.3173
Total score value
-72.6544

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 P A 0.0388
8 L A 1.5345
9 F A 0.4813
10 A A 0.0013
11 P A -0.2663
12 G A -0.6462
13 E A -2.1631
14 D A -2.1324
15 C A 0.0000
16 G A -0.2299
17 P A -0.2777
18 A A 0.0000
19 W A 0.0000
20 R A -1.6038
21 A A -0.2560
22 A A 0.0000
23 P A -0.2478
24 A A -0.0135
25 A A -0.0007
26 Y A -0.0126
27 D A -1.7467
28 T A -0.4452
29 S A -0.5476
30 D A -1.8303
31 T A -0.4145
32 H A -0.3705
33 L A 0.0000
34 Q A -0.6008
35 I A 0.0000
36 L A 1.4638
37 G A -0.2418
38 K A -0.4047
39 P A -0.1846
40 V A 0.0000
41 M A 0.0000
42 E A -0.7909
43 R A -0.5704
44 W A 0.0000
45 E A -0.2848
46 T A -0.1229
47 P A -0.0983
48 Y A 0.0000
49 M A 0.0000
50 H A -0.3176
51 S A -0.0857
52 L A 0.0000
53 A A 0.0000
54 A A 0.0467
55 A A 0.0160
56 A A 0.0000
57 A A -0.0567
58 S A -0.4829
59 R A -1.5118
60 G A -0.4025
61 G A -0.2344
62 R A -0.4381
63 V A 0.0000
64 L A 0.0000
65 E A -0.2423
66 V A 0.0000
67 G A 0.0000
68 F A 0.0000
69 G A -0.0899
70 M A 0.0000
71 A A 0.3445
72 I A 1.5385
73 A A 0.2552
74 A A -0.0128
75 S A -0.4308
76 R A -1.4858
77 V A 0.0000
78 Q A -0.8538
79 Q A -1.4172
80 A A -0.2504
81 P A -0.2520
82 I A 0.0000
83 K A -1.7590
84 E A -0.6798
85 H A 0.0000
86 W A 0.2446
87 I A 0.0000
88 I A 0.0000
89 E A 0.0000
90 C A -0.1354
91 N A 0.0000
92 D A -0.2280
93 G A -0.1460
94 V A 0.0000
95 F A 0.2432
96 Q A -1.2188
97 R A -1.6251
98 L A 0.0192
99 Q A -0.7809
100 N A -1.1569
101 W A 0.9918
102 A A 0.0000
103 L A 0.8606
104 K A -1.7040
105 Q A -1.5415
106 P A -0.3503
107 H A -0.6065
108 K A -1.7038
109 V A 0.1037
110 V A 0.9755
111 P A 0.1276
112 L A 0.2824
113 K A -0.6564
114 G A -0.2746
115 L A 0.2016
116 W A 0.0000
117 E A -2.1039
118 E A -1.9413
119 V A 0.0000
120 A A -0.0137
121 P A -0.2619
122 T A -0.1183
123 L A 0.0000
124 P A -0.5837
125 D A -1.8522
126 G A -0.5398
127 H A -0.7557
128 F A 0.0000
129 D A -0.2006
130 G A 0.0000
131 I A 0.0000
132 L A 0.0000
133 Y A 0.0000
134 D A 0.0000
135 T A 0.0172
136 Y A 0.1358
137 P A -0.0155
138 L A 0.0000
139 S A -0.2516
140 E A -1.3713
141 E A -2.0104
142 T A -0.3310
143 W A 0.0000
144 H A -0.3487
145 T A -0.2424
146 H A -0.5335
147 Q A 0.0000
148 F A 0.1196
149 N A -1.1540
150 F A 0.0888
151 I A 0.0000
152 K A -1.4206
153 T A -0.3964
154 H A -0.4105
155 A A 0.0000
156 F A -0.1006
157 R A -1.7881
158 L A 0.0000
159 L A 0.0000
160 K A -0.9593
161 P A -0.4567
162 G A -0.2908
163 G A 0.0000
164 I A 0.0000
165 L A 0.0000
166 T A 0.0000
167 Y A 0.0000
168 C A 0.0000
169 N A -0.1795
170 L A 0.0000
171 T A -0.0117
172 S A -0.0223
173 W A 0.0000
174 G A 0.0000
175 E A -1.7890
176 L A -0.1644
177 M A -0.3445
178 K A -1.7140
179 S A -0.7981
180 K A -1.6335
181 Y A -0.1854
182 T A -0.1624
183 D A -0.8110
184 I A 0.0000
185 T A -0.0020
186 A A 0.0976
187 M A 0.3418
188 F A 0.0000
189 E A -1.7745
190 E A -2.0817
191 T A -0.3601
192 Q A -0.0370
193 V A 0.4889
194 P A 0.1537
195 A A 0.0000
196 L A 0.0000
197 L A 0.7111
198 E A -1.5011
199 A A -0.5320
200 G A -0.4177
201 F A -0.0804
202 Q A -1.4857
203 R A -2.3872
204 E A -2.3688
205 N A -1.4987
206 I A 0.3097
207 C A 0.4451
208 T A -0.1417
209 E A -0.6687
210 V A 1.6352
211 M A 0.5430
212 A A 0.1000
213 L A 0.5676
214 V A 1.7916
215 P A 0.0000
216 P A -0.2530
217 A A -0.3657
218 D A -1.7523
219 C A -0.4713
220 R A -1.7769
221 Y A -0.1609
222 Y A 0.1571
223 A A 0.0406
224 F A 0.0000
225 P A -0.0406
226 Q A -0.3655
227 M A 0.0000
228 I A 0.0000
229 T A 0.0000
230 P A 0.0294
231 L A 0.2954
232 V A 0.0000
233 T A 0.0000
234 K A -0.9239
235 H A -1.1430

 

Laboratory of Theory of Biopolymers 2015