Project name: 6a3w:A

Status: done

submitted: 2019-03-21 13:20:20, status changed: 2019-03-21 13:29:11
Settings
Chain sequence(s) A: EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGKIYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGYGIFDYWGQGTLVTVSS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.4993
Maximal score value
1.9508
Average score
-0.4204
Total score value
-48.7648

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1195
2 V A -1.2048
3 Q A -1.3258
4 L A 0.0000
5 V A 0.5208
6 Q A 0.0000
7 S A -0.4353
8 G A -0.4049
9 A A 0.3006
10 E A 0.2143
11 V A 1.1154
12 K A -1.0239
13 K A -2.3814
14 P A -2.2721
15 G A -1.9849
16 E A -2.1448
17 S A -1.8407
18 L A 0.0000
19 R A -2.1771
20 I A 0.0000
21 S A -0.5462
22 C A 0.0000
23 K A -0.7523
24 G A 0.0000
25 S A -0.7796
26 G A -1.1915
27 Y A -0.4646
28 S A -0.2976
29 F A 0.0000
30 S A -0.8012
31 T A -0.0771
32 Y A 1.0050
33 W A 1.0835
34 I A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.1932
39 Q A -0.4250
40 M A -0.6610
41 P A -0.9948
42 G A -1.3758
43 K A -2.0251
44 G A -0.9056
45 L A 0.6105
46 E A 0.0075
47 W A 0.4747
48 M A 0.0000
49 G A 0.0000
50 K A 0.3159
51 I A 0.0000
52 Y A 0.3195
53 P A 0.0000
54 G A -1.1561
55 D A -1.7673
56 S A -0.7596
57 Y A 0.6596
58 T A 0.2195
59 N A -0.3167
60 Y A -0.6729
61 S A -0.5728
62 P A -0.9508
63 S A -0.8971
64 F A 0.0000
65 Q A -1.8965
66 G A -1.5834
67 Q A -1.7730
68 V A 0.0000
69 T A -0.9572
70 I A 0.0000
71 S A -0.5209
72 A A -0.9436
73 D A -1.7018
74 K A -2.2102
75 S A -0.6836
76 I A 0.2224
77 S A -0.7276
78 T A 0.0000
79 A A 0.0000
80 Y A -0.7396
81 L A 0.0000
82 Q A -1.5568
83 W A 0.0000
84 S A -1.3614
85 S A -1.6899
86 L A 0.0000
87 K A -2.4993
88 A A -1.4361
89 S A -0.7857
90 D A 0.0000
91 T A -0.1791
92 A A 0.0000
93 M A 0.4521
94 Y A 0.0000
95 Y A 0.3962
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A 1.2843
100 Y A 1.7479
101 G A 1.1339
102 I A 1.9508
103 F A 1.0556
104 D A -0.5381
105 Y A -0.1328
106 W A 0.1567
107 G A -0.1403
108 Q A -0.7591
109 G A -0.1359
110 T A 0.0000
111 L A 0.8095
112 V A 0.0000
113 T A 0.1336
114 V A 0.0000
115 S A -0.9303
116 S A -1.1733

 

Laboratory of Theory of Biopolymers 2015