Project name: ucht1

Chain sequence(s)	A: EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWMGLINPYKGVSTYNQKFKDKATLTVDKSSSTAYMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTVF
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)

• Minimal score value: -3.5521
• Maximal score value: 1.644
• Average score: -0.5635
• Total score value: -68.1788

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9860
2	V	A	-1.1393
3	Q	A	-1.5976
4	L	A	0.0000
5	Q	A	-1.7972
6	Q	A	0.0000
7	S	A	-1.2781
8	G	A	-1.2487
9	P	A	-0.8839
10	E	A	-1.1793
11	L	A	0.8478
12	V	A	0.0752
13	K	A	-0.9122
14	P	A	-0.7361
15	G	A	-0.9709
16	A	A	-0.7231
17	S	A	-0.8002
18	M	A	0.0000
19	K	A	-2.0266
20	I	A	0.0000
21	S	A	-0.8971
22	C	A	0.0000
23	K	A	-1.5413
24	A	A	0.0000
25	S	A	-1.1466
26	G	A	-1.0921
27	Y	A	-0.4001
28	S	A	-0.0165
29	F	A	0.0000
30	T	A	0.0707
31	G	A	0.7385
32	Y	A	0.7307
33	T	A	0.6150
34	M	A	0.0000
35	N	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	K	A	-0.7392
39	Q	A	-1.3224
40	S	A	-1.9209
41	H	A	-2.1194
42	G	A	-1.9965
43	K	A	-2.9123
44	N	A	-2.2239
45	L	A	-0.7163
46	E	A	-1.3503
47	W	A	-0.2999
48	M	A	0.0000
49	G	A	0.0000
50	L	A	0.5153
51	I	A	0.0000
52	N	A	0.2369
53	P	A	0.0000
54	Y	A	0.3727
55	K	A	-0.8497
56	G	A	-0.5008
57	V	A	0.7489
58	S	A	0.3513
59	T	A	-0.0559
60	Y	A	-1.1791
61	N	A	-1.9403
62	Q	A	-3.0066
63	K	A	-3.2433
64	F	A	0.0000
65	K	A	-3.5521
66	D	A	-3.1613
67	K	A	-2.0108
68	A	A	0.0000
69	T	A	-0.9722
70	L	A	0.0000
71	T	A	-0.1398
72	V	A	-0.6292
73	D	A	-1.6349
74	K	A	-1.9625
75	S	A	-1.2849
76	S	A	-1.1302
77	S	A	-1.2473
78	T	A	0.0000
79	A	A	0.0000
80	Y	A	-0.5442
81	M	A	0.0000
82	E	A	-1.1795
83	L	A	0.0000
84	L	A	-0.3288
85	S	A	-0.5994
86	L	A	0.0000
87	T	A	-0.8204
88	S	A	-0.8797
89	E	A	-2.0583
90	D	A	0.0000
91	S	A	-0.5431
92	A	A	0.0000
93	V	A	-0.0784
94	Y	A	0.0000
95	Y	A	0.1408
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.0000
99	S	A	0.5077
100	G	A	0.2064
101	Y	A	0.6749
102	Y	A	0.2786
103	G	A	-0.9308
104	D	A	-1.5997
105	S	A	-0.7733
106	D	A	-0.2341
107	W	A	1.0593
108	Y	A	1.3194
109	F	A	0.7781
110	D	A	-0.4682
111	V	A	-0.1306
112	W	A	-0.0933
113	G	A	0.0000
114	Q	A	-1.3688
115	G	A	-0.7058
116	T	A	0.0000
117	T	A	-0.4493
118	L	A	0.0000
119	T	A	0.1696
120	V	A	0.0000
121	F	A	1.6440