Project name: 4AJY_W88L [mutate: WL88V]

Status: done

Started: 2020-09-18 14:30:32
Settings
Chain sequence(s) V: RPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIA
input PDB
Selected Chain(s) V
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode Yes
Automated mutations No
Mutated residues WL88V
Energy difference between WT (input) and mutated protein (by FoldX) 0.0238342 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with V chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:36)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:40)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:30)
[INFO]       Analysis: Starting Aggrescan3D on model_5.pdb                                         (00:26:47)
[INFO]       Analysis: Starting Aggrescan3D on model_4.pdb                                         (00:26:48)
[INFO]       Analysis: Starting Aggrescan3D on model_10.pdb                                        (00:26:48)
[INFO]       Analysis: Starting Aggrescan3D on model_0.pdb                                         (00:26:49)
[INFO]       Analysis: Starting Aggrescan3D on model_8.pdb                                         (00:26:50)
[INFO]       Analysis: Starting Aggrescan3D on model_7.pdb                                         (00:26:51)
[INFO]       Analysis: Starting Aggrescan3D on model_6.pdb                                         (00:26:51)
[INFO]       Analysis: Starting Aggrescan3D on model_2.pdb                                         (00:26:52)
[INFO]       Analysis: Starting Aggrescan3D on model_1.pdb                                         (00:26:53)
[INFO]       Analysis: Starting Aggrescan3D on model_9.pdb                                         (00:26:54)
[INFO]       Analysis: Starting Aggrescan3D on model_3.pdb                                         (00:26:54)
[INFO]       Analysis: Starting Aggrescan3D on model_11.pdb                                        (00:26:55)
[INFO]       Analysis: Starting Aggrescan3D on input.pdb                                           (00:26:55)
[WARNING]    CABS:     Pymol failed to launch (most likely not present on the system).Couldn't     
                       create a superimposed picture of CABS input and output                      (00:26:57)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:26:57)
[CRITICAL]   pyMol:    Pymol encountered an error: /bin/sh: pymol: command not found Movie         
                       creation failed.                                                            (00:26:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:26:58)
Show buried residues

Minimal score value
-4.1772
Maximal score value
1.9664
Average score
-0.7839
Total score value
-116.0199

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
60 R V -1.7528
61 P V -0.8261
62 V V 0.8598
63 L V 0.0000
64 R V -1.0192
65 S V 0.0000
66 V V -0.2103
67 N V -1.0041
68 S V -1.3848
69 R V -2.3833
70 E V -1.7018
71 P V -1.1561
72 S V 0.0000
73 Q V -0.9628
74 V V 0.0000
75 I V -0.6833
76 F V 0.0000
77 C V 0.0000
78 N V 0.0000
79 R V -2.2267
80 S V 0.0000
81 P V -0.6082
82 R V -0.1399
83 V V 0.7862
84 V V 0.0000
85 L V 0.2400
86 P V 0.0000
87 V V 0.0000
88 L V -0.2874 mutated: WL88V
89 L V 0.0000
90 N V -1.2556
91 F V -0.9502
92 D V -2.4022
93 G V -1.9179
94 E V -2.7884
95 P V -1.6589
96 Q V -1.0714
97 P V -0.2410
98 Y V 0.3245
99 P V 0.0185
100 T V 0.1858
101 L V 0.0000
102 P V -0.3017
103 P V -0.7634
104 G V -1.2364
105 T V -0.9910
106 G V -1.4668
107 R V -1.5562
108 R V -2.1495
109 I V -1.2542
110 H V -1.2908
111 S V 0.0000
112 Y V -0.6736
113 R V -0.6294
114 G V -0.0406
115 H V 0.0000
116 L V 0.6881
117 W V 0.0000
118 L V 0.0000
119 F V 0.0000
120 R V 0.0000
121 D V 0.0000
122 A V -0.0518
123 G V -0.3779
124 T V -0.7001
125 H V -0.8268
126 D V 0.0000
127 G V -0.2478
128 L V 0.0000
129 L V -0.0864
130 V V 0.0000
131 N V -1.0669
132 Q V -1.4205
133 T V -0.8750
134 E V -0.6238
135 L V 0.1734
136 F V 0.0000
137 V V 1.2602
138 P V 0.0000
139 S V 0.5594
140 L V 0.6273
141 N V 0.0244
142 V V 0.5601
143 D V -1.4647
144 G V -1.3281
145 Q V -1.2387
146 P V -0.5710
147 I V 0.6909
148 F V 0.4851
149 A V 0.0000
150 N V -0.9056
151 I V 0.0000
152 T V -0.5859
153 L V 0.5078
154 P V 0.9372
155 V V 1.9664
156 Y V 0.7448
157 T V 0.2289
158 L V 0.6437
159 K V -1.1235
160 E V -1.3513
161 R V -0.7502
162 C V -0.1140
163 L V 0.0000
164 Q V 0.0000
165 V V 0.8672
166 V V 0.8291
167 R V -0.1993
168 S V 0.5131
169 L V 1.3861
170 V V -0.4311
171 K V -2.1651
172 P V -2.5907
173 E V -3.4167
174 N V -3.1105
175 Y V 0.0000
176 R V -3.5327
177 R V -3.2525
178 L V -1.7122
179 D V -1.8946
180 I V -0.1124
181 V V 0.7769
182 R V -1.5909
183 S V -0.9012
184 L V -1.0475
185 Y V 0.0000
186 E V -3.4497
187 D V -2.8854
188 L V 0.0000
189 E V -3.3808
190 D V -3.4846
191 H V -2.9026
192 P V -1.9334
193 N V -2.1483
194 V V -1.8169
195 Q V -3.0217
196 K V -3.2970
197 D V -2.7534
198 L V 0.0000
199 E V -4.0990
200 R V -4.1772
201 L V -2.5079
202 T V -1.9356
203 Q V -2.5768
204 E V -2.9347
205 R V -1.5227
206 I V 0.8088
207 A V -0.2325
Download PDB file
View in 3Dmol
Play the video

CABS-flex predictions of flexibility of input structure

In dynamic mode, A3D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A3D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A3D score, -0.7839 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A3D Score
input -0.7839 View CSV PDB
model_9 -0.8029 View CSV PDB
model_8 -0.8144 View CSV PDB
model_10 -0.8356 View CSV PDB
model_11 -0.8481 View CSV PDB
model_0 -0.8692 View CSV PDB
model_2 -0.8729 View CSV PDB
model_5 -0.8824 View CSV PDB
model_7 -0.8914 View CSV PDB
model_1 -0.8969 View CSV PDB
model_6 -0.9044 View CSV PDB
model_3 -0.9055 View CSV PDB
model_4 -0.9882 View CSV PDB
 

Laboratory of Theory of Biopolymers 2018