Project name: 2ac8cf94732742b

Status: done

Started: 2024-04-27 12:53:03
Settings
Chain sequence(s) X: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLR
input PDB
Selected Chain(s) X
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with X chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-4.1996
Maximal score value
1.3091
Average score
-0.9289
Total score value
-153.2653

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M X 0.8702
2 S X -0.1183
3 Y X 0.0000
4 N X -0.8792
5 L X 0.9554
6 L X 0.0000
7 G X 0.0000
8 F X 1.3091
9 L X 1.0629
10 Q X 0.0000
11 R X -0.3496
12 S X 0.3048
13 S X 0.0000
14 N X 0.0000
15 F X 0.8872
16 Q X -0.6385
17 C X 0.0000
18 Q X -0.1473
19 K X -0.8127
20 L X 0.0000
21 L X 0.0000
22 W X -0.0781
23 Q X -1.1535
24 L X 0.0000
25 N X -1.9394
26 G X -1.5953
27 R X -2.2335
28 L X -0.7979
29 E X -1.1886
30 Y X 0.2782
31 C X 0.0000
32 L X 0.2730
33 K X -1.2972
34 D X -1.4892
35 R X -2.1872
36 M X -1.6363
37 N X -2.0540
38 F X -1.6371
39 D X -2.3530
40 I X 0.0000
41 P X -1.8581
42 E X -2.6726
43 E X -1.6550
44 I X 0.0000
45 K X -1.8421
46 Q X -1.6032
47 L X -1.3230
48 Q X -1.8797
49 Q X -1.9874
50 F X -1.5443
51 Q X -1.9818
52 K X -1.8553
53 E X -1.1566
54 D X -1.2743
55 A X 0.0000
56 A X 0.0000
57 L X 0.0000
58 T X 0.0000
59 I X 0.0000
60 Y X 0.0000
61 E X 0.0000
62 M X 0.0000
63 L X 0.0000
64 Q X -0.4816
65 N X -0.7187
66 I X 0.0000
67 F X -0.2191
68 A X -0.9589
69 I X 0.0000
70 F X 0.0000
71 R X -2.5415
72 Q X -1.9847
73 D X -2.4945
74 S X -1.7991
75 S X -1.1480
76 S X -0.9610
77 T X -1.1753
78 G X -1.5117
79 W X 0.0000
80 N X -2.3656
81 E X -2.8671
82 T X -1.9567
83 I X -1.5754
84 V X -2.1073
85 E X -3.0835
86 N X -2.2036
87 L X 0.0000
88 L X 0.0000
89 A X -0.8604
90 N X -0.7194
91 V X 0.0000
92 Y X -0.1906
93 H X -1.1512
94 Q X 0.0000
95 I X 0.0000
96 N X -1.6703
97 H X -1.0048
98 L X 0.0000
99 K X -2.3653
100 T X -1.4627
101 V X -0.9043
102 L X 0.0000
103 E X -3.9715
104 E X -4.1996
105 K X -3.3860
106 L X 0.0000
107 E X -4.0610
108 K X -3.8086
109 E X -3.4818
110 D X 0.0000
111 F X -0.1663
112 T X -0.6880
113 R X -2.1158
114 G X -1.5427
115 K X -1.8690
116 L X -0.9408
117 M X 0.0000
118 S X -0.6168
119 S X -0.4826
120 L X -0.1148
121 H X -1.5686
122 L X 0.0000
123 K X -3.0056
124 R X -3.0254
125 Y X 0.0000
126 Y X 0.0000
127 G X -2.3714
128 R X -2.9741
129 I X 0.0000
130 L X -1.3374
131 H X -2.3094
132 Y X 0.0000
133 L X 0.0000
134 K X -2.9782
135 A X -2.0806
136 K X -2.5251
137 E X -2.9712
138 Y X -2.0012
139 S X -1.2342
140 H X -0.6758
141 C X -0.5844
142 A X 0.0000
143 W X 0.0000
144 T X 0.0000
145 I X 0.0000
146 V X 0.0000
147 R X 0.0000
148 V X 0.5590
149 E X -0.2018
150 I X 0.0000
151 L X 0.0000
152 R X -0.3028
153 N X 0.0000
154 F X 0.0000
155 Y X 0.3254
156 F X 0.0000
157 I X 0.0000
158 N X -0.8944
159 R X -1.8300
160 L X 0.0000
161 T X 0.0000
162 G X -1.2655
163 Y X -1.0928
164 L X 0.0000
165 R X -1.7137
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018