Project name: A07

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPTGWEYGDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.9754
• Maximal score value: 1.6783
• Average score: -0.751
• Total score value: -102.1337

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9613
2	V	A	-0.8794
3	Q	A	-0.7386
4	L	A	0.0000
5	V	A	1.2198
6	E	A	0.4974
7	S	A	-0.2531
8	G	A	-0.8720
9	G	A	0.0537
10	G	A	0.5490
11	L	A	1.1667
12	V	A	-0.0085
13	Q	A	-1.0411
14	P	A	-1.5198
15	G	A	-1.3616
16	G	A	-0.8271
17	S	A	-1.1993
18	L	A	-0.9541
19	R	A	-2.1429
20	L	A	0.0000
21	S	A	-0.3995
22	C	A	0.0000
23	A	A	-0.0106
24	A	A	-0.5312
25	S	A	-0.8954
26	G	A	-1.3892
27	F	A	-1.5683
28	R	A	-2.9754
29	I	A	0.0000
30	S	A	-2.2998
31	D	A	-2.8652
32	E	A	-2.0183
33	D	A	-1.1273
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4990
40	A	A	-1.0269
41	P	A	-1.1295
42	G	A	-1.5891
43	K	A	-2.1271
44	G	A	-1.0033
45	L	A	0.5315
46	E	A	-0.3382
47	W	A	0.3138
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.4834
53	G	A	-1.4969
54	P	A	-1.1888
55	S	A	-0.7627
56	G	A	-0.6557
57	S	A	-0.1713
58	T	A	0.2795
59	Y	A	0.5452
60	Y	A	-0.3908
61	A	A	0.0000
62	D	A	-2.3667
63	S	A	-1.7477
64	V	A	0.0000
65	K	A	-2.4575
66	G	A	-1.7077
67	R	A	-1.4269
68	F	A	0.0000
69	T	A	-0.7330
70	I	A	0.0000
71	S	A	-0.5137
72	R	A	-1.1450
73	D	A	-1.7796
74	N	A	-2.7657
75	S	A	-2.0585
76	K	A	-2.6531
77	N	A	-2.2291
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6160
81	L	A	0.0000
82	Q	A	-1.2804
83	M	A	0.0000
84	N	A	-1.5141
85	S	A	-1.3269
86	L	A	0.0000
87	R	A	-2.7988
88	A	A	-1.9038
89	E	A	-2.4519
90	D	A	0.0000
91	T	A	-0.5310
92	A	A	0.0000
93	V	A	0.9188
94	Y	A	0.0000
95	Y	A	0.5944
96	C	A	0.0000
97	A	A	0.0000
98	R	A	-0.5495
99	G	A	-0.8551
100	P	A	-0.6636
101	T	A	-0.0608
102	G	A	-0.0520
103	W	A	0.4615
104	E	A	-1.0155
105	Y	A	0.1476
106	G	A	-0.5174
107	D	A	-1.3934
108	Y	A	-0.0439
109	W	A	0.1864
110	G	A	0.0000
111	Q	A	-0.7735
112	G	A	0.1271
113	T	A	0.6316
114	L	A	1.6783
115	V	A	0.0000
116	T	A	0.3610
117	V	A	0.0000
118	S	A	-0.7385
119	S	A	-0.6801
120	G	A	-0.7095
121	P	A	-0.8545
122	G	A	-0.7245
123	G	A	-0.9656
124	Q	A	-1.3182
125	L	A	0.0733
126	P	A	-0.9379
127	E	A	-1.9566
128	T	A	-1.2987
129	G	A	-1.7166
130	G	A	-1.8372
131	H	A	-2.2091
132	H	A	-2.5141
133	H	A	-2.6420
134	H	A	-2.5779
135	H	A	-2.3315
136	H	A	-1.8243