Project name: 3316a42dae859a6

Status: done

Started: 2024-04-23 09:25:34
Settings
Chain sequence(s) A: HAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLALRQAGDDFSRRYRGDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:15)
Show buried residues

Minimal score value
-4.2629
Maximal score value
1.174
Average score
-1.431
Total score value
-234.6845

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 H A -1.3385
4 A A -1.1134
5 G A -1.7074
6 R A -2.3358
7 T A -1.6428
8 G A -1.7122
9 Y A 0.0000
10 D A -3.2238
11 N A -3.0503
12 R A -3.2536
13 E A -3.1003
14 I A 0.0000
15 V A 0.0000
16 M A -1.6807
17 K A -1.8667
18 Y A 0.0000
19 I A 0.0000
20 H A -1.8026
21 Y A -1.0761
22 K A -1.3227
23 L A 0.0000
24 S A -1.9890
25 Q A -2.3486
26 R A -2.8031
27 G A -2.1536
28 Y A -1.8219
29 E A -2.5933
30 W A -2.1557
31 D A -3.2291
32 A A -2.2855
33 G A -2.5350
34 D A -3.4508
35 D A -3.2902
36 V A -2.4517
37 E A -3.6139
38 E A -3.9780
39 N A -3.2930
40 R A -3.6506
41 T A -2.4489
42 E A -3.2261
43 A A -2.0175
44 P A -1.8095
45 E A -2.4586
46 G A -1.9329
47 T A -1.4876
48 E A -1.7795
49 S A -1.7441
50 E A -1.6637
92 V A -1.0192
93 V A 0.0000
94 H A -0.5283
95 L A 0.0169
96 A A 0.0000
97 L A 0.0000
98 R A -1.5358
99 Q A -1.8513
100 A A 0.0000
101 G A 0.0000
102 D A -2.5609
103 D A -2.6645
104 F A -2.1142
105 S A -2.4306
106 R A -3.4798
107 R A -2.9931
108 Y A -1.6442
109 R A -3.2218
110 G A -2.5242
111 D A -2.4298
112 F A -1.3737
113 A A -1.6543
114 E A -2.7100
115 M A -1.7462
116 S A -1.3074
117 S A -1.4119
118 Q A -1.7665
119 L A -1.2255
120 H A -1.0969
121 L A -0.5645
122 T A -0.2006
123 P A 0.3116
124 F A 1.1740
125 T A -0.2569
126 A A 0.0000
127 R A -1.8255
128 G A -1.4915
129 R A -2.0582
130 F A 0.0000
131 A A -1.5911
132 T A -2.0291
133 V A 0.0000
134 V A 0.0000
135 E A -3.6699
136 E A -3.8795
137 L A 0.0000
138 F A 0.0000
139 R A -4.2629
140 D A -3.7064
141 G A -2.3025
142 V A -1.6991
143 N A -1.8849
144 W A 0.0000
145 G A -0.8723
146 R A -1.7794
147 I A 0.0000
148 V A 0.0000
149 A A 0.0000
150 F A 0.0000
151 F A 0.0000
152 E A 0.0000
153 F A 0.0000
154 G A 0.0000
155 G A 0.0000
156 V A -0.0353
157 M A 0.0000
158 C A 0.0000
159 V A -0.9098
160 E A -1.6230
161 S A 0.0000
162 V A -1.6375
163 N A -2.7360
164 R A -3.3278
165 E A -3.0882
166 M A -1.7343
167 S A -1.2174
168 P A -0.7689
169 L A 0.0000
170 V A 0.0000
171 D A -1.2280
172 N A -0.9164
173 I A 0.0000
174 A A 0.0000
175 L A -0.2556
176 W A -0.4780
177 M A 0.0000
178 T A 0.0000
179 E A -2.2386
180 Y A -1.6114
181 L A 0.0000
182 N A -2.8971
183 R A -3.0666
184 H A -2.0231
185 L A 0.0000
186 H A -2.1228
187 T A -1.5956
188 W A -1.5739
189 I A 0.0000
190 Q A -2.5571
191 D A -2.6903
192 N A -2.3569
193 G A -2.2663
194 G A -1.8210
195 W A -1.2946
196 D A -2.3200
197 A A -1.5838
198 F A 0.0000
199 V A -0.8214
200 E A -1.4616
201 L A 0.4346
202 Y A 0.3115
203 G A -0.5872
204 P A -0.3673
205 S A -0.5464
206 M A 0.0292
207 R A -1.4004
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018