Project name: D05

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPTGWAYGDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.981
• Maximal score value: 1.7121
• Average score: -0.7027
• Total score value: -95.5704

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9697
2	V	A	-0.8956
3	Q	A	-0.7591
4	L	A	0.0000
5	V	A	1.2141
6	E	A	0.4928
7	S	A	-0.2572
8	G	A	-0.8726
9	G	A	0.1029
10	G	A	0.6641
11	L	A	1.4157
12	V	A	0.1098
13	Q	A	-0.9996
14	P	A	-1.4680
15	G	A	-1.3730
16	G	A	-0.8139
17	S	A	-1.2080
18	L	A	-0.9269
19	R	A	-2.1470
20	L	A	0.0000
21	S	A	-0.4033
22	C	A	0.0000
23	A	A	-0.0150
24	A	A	-0.5424
25	S	A	-0.9084
26	G	A	-1.4004
27	F	A	-1.5824
28	R	A	-2.9810
29	I	A	0.0000
30	S	A	-2.2892
31	D	A	-2.8536
32	E	A	-1.9969
33	D	A	-1.1176
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.5117
40	A	A	-1.0348
41	P	A	-1.3176
42	G	A	-1.5929
43	K	A	-2.1288
44	G	A	-1.0028
45	L	A	0.5373
46	E	A	-0.3166
47	W	A	0.3155
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.4463
53	G	A	-1.4397
54	P	A	-1.1140
55	S	A	-0.6768
56	G	A	-0.6324
57	S	A	-0.1581
58	T	A	0.2759
59	Y	A	0.5195
60	Y	A	-0.4105
61	A	A	0.0000
62	D	A	-2.3702
63	S	A	-1.7448
64	V	A	0.0000
65	K	A	-2.4615
66	G	A	-1.7088
67	R	A	-1.6151
68	F	A	0.0000
69	T	A	-0.7411
70	I	A	0.0000
71	S	A	-0.5133
72	R	A	-1.1448
73	D	A	-1.7838
74	N	A	-2.7726
75	S	A	-2.0627
76	K	A	-2.6593
77	N	A	-2.2413
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6190
81	L	A	0.0000
82	Q	A	-1.2897
83	M	A	0.0000
84	N	A	-1.5223
85	S	A	-1.3366
86	L	A	0.0000
87	R	A	-2.8253
88	A	A	-1.9095
89	E	A	-2.4785
90	D	A	0.0000
91	T	A	-0.5029
92	A	A	0.0000
93	V	A	0.9149
94	Y	A	0.0000
95	Y	A	0.5893
96	C	A	0.0000
97	A	A	0.0000
98	R	A	-0.5467
99	G	A	-0.3573
100	P	A	-0.2119
101	T	A	0.2800
102	G	A	0.4168
103	W	A	1.3114
104	A	A	0.8159
105	Y	A	1.0502
106	G	A	0.0000
107	D	A	-1.1085
108	Y	A	-0.0382
109	W	A	0.1761
110	G	A	0.0000
111	Q	A	-0.7801
112	G	A	0.1216
113	T	A	0.6299
114	L	A	1.7121
115	V	A	0.0000
116	T	A	0.4465
117	V	A	0.0000
118	S	A	-0.6955
119	S	A	-0.6513
120	G	A	-0.6662
121	P	A	-0.8362
122	G	A	-0.6995
123	G	A	-0.9520
124	Q	A	-1.3168
125	L	A	0.0552
126	P	A	-0.9381
127	E	A	-1.9539
128	T	A	-1.3068
129	G	A	-1.7454
130	G	A	-1.8630
131	H	A	-2.2242
132	H	A	-2.5337
133	H	A	-2.6649
134	H	A	-2.5916
135	H	A	-2.3536
136	H	A	-1.8356