Project name: F03

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPTGWSGGDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -2.9778
• Maximal score value: 1.6922
• Average score: -0.7551
• Total score value: -102.6972

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9526
2	V	A	-0.8635
3	Q	A	-0.7422
4	L	A	0.0000
5	V	A	1.2198
6	E	A	0.4047
7	S	A	-0.2644
8	G	A	-0.8762
9	G	A	0.0720
10	G	A	0.6005
11	L	A	1.2757
12	V	A	0.0453
13	Q	A	-1.0205
14	P	A	-1.5138
15	G	A	-1.3610
16	G	A	-0.8133
17	S	A	-1.1975
18	L	A	-0.9413
19	R	A	-2.1432
20	L	A	0.0000
21	S	A	-0.4052
22	C	A	0.0000
23	A	A	-0.0137
24	A	A	-0.5302
25	S	A	-0.8908
26	G	A	-1.3825
27	F	A	-1.5745
28	R	A	-2.9778
29	I	A	0.0000
30	S	A	-2.2863
31	D	A	-2.8640
32	E	A	-2.0552
33	D	A	-1.1615
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.5053
40	A	A	-1.0368
41	P	A	-1.3222
42	G	A	-1.5924
43	K	A	-2.1263
44	G	A	-0.9995
45	L	A	0.5418
46	E	A	-0.3073
47	W	A	0.3462
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.4637
53	G	A	-1.4627
54	P	A	-1.1351
55	S	A	-0.7361
56	G	A	-0.6363
57	S	A	-0.1602
58	T	A	0.2837
59	Y	A	0.5364
60	Y	A	-0.3950
61	A	A	0.0000
62	D	A	-2.3628
63	S	A	-1.7642
64	V	A	0.0000
65	K	A	-2.4520
66	G	A	-1.7052
67	R	A	-1.4241
68	F	A	0.0000
69	T	A	-0.7310
70	I	A	0.0000
71	S	A	-0.5103
72	R	A	-1.1393
73	D	A	-1.7727
74	N	A	-2.7370
75	S	A	-2.0453
76	K	A	-2.6485
77	N	A	-2.2297
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6177
81	L	A	0.0000
82	Q	A	-1.2775
83	M	A	0.0000
84	N	A	-1.5149
85	S	A	-1.3278
86	L	A	0.0000
87	R	A	-2.8019
88	A	A	-1.9064
89	E	A	-2.4800
90	D	A	0.0000
91	T	A	-0.5189
92	A	A	0.0000
93	V	A	0.9140
94	Y	A	0.0000
95	Y	A	0.5890
96	C	A	0.0000
97	A	A	0.0000
98	R	A	-0.8122
99	G	A	-0.8708
100	P	A	-0.6315
101	T	A	-0.0296
102	G	A	0.0847
103	W	A	0.7998
104	S	A	-0.2447
105	G	A	-0.8196
106	G	A	-1.0130
107	D	A	-1.6845
108	Y	A	-0.3037
109	W	A	0.1713
110	G	A	0.0000
111	Q	A	-0.7774
112	G	A	0.1205
113	T	A	0.6281
114	L	A	1.6922
115	V	A	0.0000
116	T	A	0.4001
117	V	A	0.0000
118	S	A	-0.7216
119	S	A	-0.6580
120	G	A	-0.6815
121	P	A	-0.8330
122	G	A	-0.6914
123	G	A	-0.9549
124	Q	A	-1.3050
125	L	A	0.0720
126	P	A	-0.9290
127	E	A	-1.9431
128	T	A	-1.2959
129	G	A	-1.6968
130	G	A	-1.8288
131	H	A	-2.2089
132	H	A	-2.5092
133	H	A	-2.6412
134	H	A	-2.5789
135	H	A	-2.3280
136	H	A	-1.8255