Project name: 516da553a595ac5
Status: error
Started: 2020-07-02 16:27:48
Settings
| Chain sequence(s) |
A: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
input PDB
|
| Selected Chain(s) |
A |
| Distance of aggregation |
10 Å |
| FoldX usage |
Yes |
| Dynamic mode |
Yes
|
| Automated mutations |
No
|
| Error log |
The server failed to produce an error log. Please contact us for more assistance. |
Note Your prediction results will be deleted after 360 days.
ALA alanine
ARG arginine
ASN asparagine
ASP aspartic acid
CYS cysteine
GLN glutamine
GLU glutamic acid
GLY glycine
HIS histidine
ILE isoleucine
LEU leucine
LYS lysine
MET methionine
PHE phenylalanine
PRO proline
SER serine
THR threonine
TRP tryptophan
TYR tyrosine
VAL valine