Project name: A08

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDINAYYWDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.955
• Maximal score value: 1.8382
• Average score: -0.6559
• Total score value: -88.5471

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9688
2	V	A	-0.9046
3	Q	A	-0.7678
4	L	A	0.0000
5	V	A	1.2088
6	E	A	0.4036
7	S	A	-0.2543
8	G	A	-0.8736
9	G	A	0.0559
10	G	A	0.5532
11	L	A	1.1710
12	V	A	-0.0173
13	Q	A	-1.0647
14	P	A	-1.5141
15	G	A	-1.3764
16	G	A	-0.8411
17	S	A	-1.1993
18	L	A	-0.9485
19	R	A	-2.1419
20	L	A	0.0000
21	S	A	-0.4010
22	C	A	0.0000
23	A	A	-0.0173
24	A	A	-0.4769
25	S	A	-0.9111
26	G	A	-1.4005
27	F	A	-1.5471
28	R	A	-2.9550
29	I	A	0.0000
30	S	A	-2.2296
31	D	A	-2.6026
32	E	A	-1.5734
33	D	A	-0.6432
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4799
40	A	A	-1.0334
41	P	A	-1.1276
42	G	A	-1.5876
43	K	A	-2.1418
44	G	A	-1.0297
45	L	A	0.5376
46	E	A	-0.3250
47	W	A	0.3958
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.1263
53	G	A	-1.1318
54	P	A	-1.0866
55	S	A	-0.6818
56	G	A	-0.5420
57	S	A	-0.0542
58	T	A	0.4505
59	Y	A	0.8352
60	Y	A	-0.2458
61	A	A	-1.0474
62	D	A	-2.2841
63	S	A	-1.7218
64	V	A	0.0000
65	K	A	-2.4255
66	G	A	-1.7079
67	R	A	-1.4270
68	F	A	0.0000
69	T	A	-0.7077
70	I	A	0.0000
71	S	A	-0.5261
72	R	A	-1.1706
73	D	A	-1.8244
74	N	A	-2.8415
75	S	A	-2.0948
76	K	A	-2.6812
77	N	A	-2.2620
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6183
81	L	A	0.0000
82	Q	A	-1.2778
83	M	A	0.0000
84	N	A	-1.5080
85	S	A	-1.3351
86	L	A	0.0000
87	R	A	-2.8086
88	A	A	-1.9135
89	E	A	-2.4524
90	D	A	0.0000
91	T	A	-0.5262
92	A	A	0.0000
93	V	A	0.9227
94	Y	A	0.0000
95	Y	A	0.6135
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.2347
99	D	A	0.0000
100	I	A	0.8012
101	N	A	-0.0244
102	A	A	0.7404
103	Y	A	1.7503
104	Y	A	1.8382
105	W	A	0.9516
106	D	A	0.1682
107	Y	A	0.5712
108	W	A	0.3938
109	G	A	0.0000
110	Q	A	-0.7864
111	G	A	0.1210
112	T	A	0.6291
113	L	A	1.6784
114	V	A	0.0000
115	T	A	0.3573
116	V	A	0.0000
117	S	A	-0.7510
118	S	A	-0.6624
119	G	A	-0.7184
120	P	A	-0.8493
121	G	A	-0.7168
122	G	A	-0.9490
123	Q	A	-1.3201
124	L	A	0.0634
125	P	A	-0.9314
126	E	A	-1.9549
127	T	A	-1.2994
128	G	A	-1.7234
129	G	A	-1.8357
130	H	A	-2.2117
131	H	A	-2.5058
132	H	A	-2.6569
133	H	A	-2.5647
134	H	A	-2.3295
135	H	A	-1.8170