Project name: E01

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPTGWDPRGDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.954
• Maximal score value: 1.7148
• Average score: -0.7989
• Total score value: -109.4519

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9777
2	V	A	-0.9030
3	Q	A	-0.7561
4	L	A	0.0000
5	V	A	1.2089
6	E	A	0.4029
7	S	A	-0.2548
8	G	A	-0.8723
9	G	A	0.1034
10	G	A	0.6709
11	L	A	1.4113
12	V	A	0.1048
13	Q	A	-0.8880
14	P	A	-1.4940
15	G	A	-1.3791
16	G	A	-0.8205
17	S	A	-1.0580
18	L	A	-0.9218
19	R	A	-2.1452
20	L	A	0.0000
21	S	A	-0.4063
22	C	A	0.0000
23	A	A	-0.0176
24	A	A	0.0000
25	S	A	-0.9140
26	G	A	-1.4159
27	F	A	-1.5472
28	R	A	-2.9540
29	I	A	0.0000
30	S	A	-2.2798
31	D	A	-2.7969
32	E	A	-1.8283
33	D	A	-1.1338
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4832
40	A	A	-1.0323
41	P	A	-1.3155
42	G	A	-1.5894
43	K	A	-2.1300
44	G	A	-1.0087
45	L	A	0.5560
46	E	A	-0.2796
47	W	A	0.5114
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.4292
53	G	A	-1.4295
54	P	A	-1.1626
55	S	A	-0.7519
56	G	A	-0.6334
57	S	A	-0.1539
58	T	A	0.3344
59	Y	A	0.6889
60	Y	A	-0.3040
61	A	A	0.0000
62	D	A	-2.3554
63	S	A	-1.7332
64	V	A	0.0000
65	K	A	-2.4460
66	G	A	-1.7092
67	R	A	-1.4289
68	F	A	0.0000
69	T	A	-0.7228
70	I	A	0.0000
71	S	A	-0.5285
72	R	A	-1.1763
73	D	A	-1.8300
74	N	A	-2.8539
75	S	A	-2.1028
76	K	A	-2.6857
77	N	A	-2.2684
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6219
81	L	A	0.0000
82	Q	A	-1.2848
83	M	A	0.0000
84	N	A	-1.5127
85	S	A	-1.3328
86	L	A	0.0000
87	R	A	-2.8095
88	A	A	-1.9140
89	E	A	-2.4779
90	D	A	0.0000
91	T	A	-0.4981
92	A	A	0.0000
93	V	A	0.9185
94	Y	A	0.0000
95	Y	A	0.5982
96	C	A	0.0000
97	A	A	0.0000
98	R	A	-0.9678
99	G	A	-1.1518
100	P	A	-0.3658
101	T	A	-0.1939
102	G	A	-0.3763
103	W	A	0.2446
104	D	A	-1.5521
105	P	A	-1.7024
106	R	A	-2.6734
107	G	A	-2.2800
108	D	A	-2.3112
109	Y	A	-0.5502
110	W	A	0.0551
111	G	A	0.0000
112	Q	A	-0.7887
113	G	A	0.1184
114	T	A	0.6289
115	L	A	1.7148
116	V	A	0.0000
117	T	A	0.4424
118	V	A	0.0000
119	S	A	-0.6925
120	S	A	-0.6335
121	G	A	-0.6717
122	P	A	-0.8232
123	G	A	-0.7120
124	G	A	-0.9785
125	Q	A	-1.2582
126	L	A	0.0823
127	P	A	-0.9145
128	E	A	-1.9517
129	T	A	-1.3036
130	G	A	-1.7108
131	G	A	-1.8340
132	H	A	-2.2062
133	H	A	-2.5104
134	H	A	-2.6391
135	H	A	-2.5787
136	H	A	-2.3289
137	H	A	-1.8266