Project name: 709a77ebe96f564

Chain sequence(s)	A: CGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:18)
[CRITICAL]   pyMol:    Pymol encountered an error: /bin/sh: pymol: command not found Movie         
                       creation failed.                                                            (00:01:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:18)

• Minimal score value: -3.9433
• Maximal score value: 1.2724
• Average score: -1.5397
• Total score value: -66.2055

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
273	C	A	0.3515
274	G	A	-0.5334
275	G	A	-1.0085
276	R	A	-1.9771
277	I	A	-0.9412
278	A	A	-1.8105
279	R	A	-3.4000
280	L	A	-2.0672
281	E	A	-3.3454
282	E	A	-3.9433
283	K	A	-3.0217
284	V	A	-1.8220
285	K	A	-3.4407
286	T	A	-2.2467
287	L	A	-1.8203
288	K	A	-2.9990
289	A	A	-2.3027
290	Q	A	-2.6427
291	N	A	-2.6644
292	S	A	-1.9888
293	E	A	-2.3883
294	L	A	-0.2426
295	A	A	-0.7839
296	S	A	-0.8854
297	T	A	-0.0207
298	A	A	-0.5304
299	N	A	-1.4771
300	M	A	0.0002
301	L	A	0.1900
302	R	A	-2.2443
303	E	A	-2.6545
304	Q	A	-1.5254
305	V	A	-1.0033
306	A	A	-1.7757
307	Q	A	-2.4013
308	L	A	-0.9584
309	K	A	-2.0750
310	Q	A	-1.9510
311	K	A	-1.6540
312	V	A	0.4490
313	M	A	0.3865
314	N	A	-0.3082
315	Y	A	1.2724