Project name: B02M5

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDWDWPWLTELDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -2.9648
• Maximal score value: 1.818
• Average score: -0.6975
• Total score value: -96.2602

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0417
2	V	A	-1.0679
3	Q	A	-1.1962
4	L	A	0.0000
5	V	A	0.7702
6	E	A	0.2073
7	S	A	-0.3155
8	G	A	-0.6663
9	G	A	0.1023
10	G	A	0.6178
11	L	A	1.2386
12	V	A	0.0464
13	Q	A	-0.8893
14	P	A	-1.5047
15	G	A	-1.4024
16	G	A	-0.8378
17	S	A	-1.1992
18	L	A	-0.9183
19	R	A	-2.0773
20	L	A	0.0000
21	S	A	-0.4340
22	C	A	0.0000
23	A	A	-0.1852
24	A	A	0.0000
25	S	A	-1.2547
26	G	A	-1.4958
27	F	A	-1.5667
28	R	A	-2.9648
29	I	A	0.0000
30	S	A	-2.2828
31	D	A	-2.7747
32	E	A	-1.7376
33	D	A	-1.0454
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4723
40	A	A	-1.0465
41	P	A	-1.3585
42	G	A	-1.4554
43	K	A	-2.1182
44	G	A	-0.9464
45	L	A	0.5437
46	E	A	-0.1214
47	W	A	0.3204
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.4862
53	G	A	-1.3071
54	P	A	-1.0645
55	S	A	-0.6924
56	G	A	-0.5561
57	S	A	-0.0925
58	T	A	0.3664
59	Y	A	0.6821
60	Y	A	-0.3006
61	A	A	0.0000
62	D	A	-2.2791
63	S	A	-1.7604
64	V	A	0.0000
65	K	A	-2.4395
66	G	A	-1.7148
67	R	A	-1.2679
68	F	A	0.0000
69	T	A	-0.7150
70	I	A	0.0000
71	S	A	-0.5317
72	R	A	-1.2047
73	D	A	-1.8993
74	N	A	-2.9003
75	S	A	-2.1487
76	K	A	-2.7391
77	N	A	-2.2931
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6217
81	L	A	0.0000
82	Q	A	-1.2303
83	M	A	0.0000
84	N	A	-1.5328
85	S	A	-1.3509
86	L	A	0.0000
87	R	A	-2.8384
88	A	A	-1.9533
89	E	A	-2.5005
90	D	A	0.0000
91	T	A	-0.5405
92	A	A	0.0000
93	V	A	0.8545
94	Y	A	0.0000
95	Y	A	0.4484
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.0000
99	D	A	-0.5458
100	W	A	-0.4613
101	D	A	-0.8275
102	W	A	1.0254
103	P	A	0.8901
104	W	A	1.7680
105	L	A	1.8180
106	T	A	0.0735
107	E	A	-0.8890
108	L	A	0.1695
109	D	A	-1.1132
110	Y	A	-0.3463
111	W	A	0.0357
112	G	A	0.0000
113	Q	A	-0.8831
114	G	A	0.0159
115	T	A	0.5782
116	L	A	1.6657
117	V	A	0.0000
118	T	A	0.3791
119	V	A	0.0000
120	S	A	-0.7613
121	S	A	-0.6755
122	G	A	-0.6920
123	P	A	-0.8136
124	G	A	-0.6582
125	G	A	-0.8948
126	Q	A	-1.2515
127	L	A	0.0922
128	P	A	-0.9111
129	E	A	-1.9448
130	T	A	-1.2686
131	G	A	-1.7031
132	G	A	-1.8453
133	H	A	-2.2203
134	H	A	-2.5155
135	H	A	-2.6619
136	H	A	-2.5855
137	H	A	-2.3232
138	H	A	-1.8388