Chain sequence(s) |
A: TQKGQKNSKTQIVESVEISEELKKCLEEKLALETGEKFKKLDDYLFERDGHRCIYSGQIINISQLLDDGLVDIEHIIPRSRSLDDSRNNKVLCYAEMNRKKGDQTAYDYIVSKRNGEMSVELRTRVLELQGMGKAKYKKLLKTESDIPEGFIDRDLRN
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 5 Å |
FoldX usage | Yes |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:07) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:07) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:07) [INFO] runJob: Creating pdb object from: input.pdb (00:00:07) [INFO] FoldX: Starting FoldX energy minimalization (00:00:07) [INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:03:23) [INFO] Auto_mut: Residue number 32 from chain A and a score of 1.448 (leucine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Residue number 120 from chain A and a score of 1.289 (valine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Residue number 83 from chain A and a score of 1.248 (leucine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Residue number 127 from chain A and a score of 1.212 (leucine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Residue number 59 from chain A and a score of 1.032 (isoleucine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Residue number 46 from chain A and a score of 0.956 (phenylalanine) selected for automated muatation (00:03:24) [INFO] Auto_mut: Mutating residue number 32 from chain A (leucine) into glutamic acid (00:03:24) [INFO] Auto_mut: Mutating residue number 120 from chain A (valine) into glutamic acid (00:03:24) [INFO] Auto_mut: Mutating residue number 32 from chain A (leucine) into aspartic acid (00:03:24) [INFO] Auto_mut: Mutating residue number 120 from chain A (valine) into lysine (00:04:52) [INFO] Auto_mut: Mutating residue number 32 from chain A (leucine) into lysine (00:04:52) [INFO] Auto_mut: Mutating residue number 32 from chain A (leucine) into arginine (00:04:57) [INFO] Auto_mut: Mutating residue number 120 from chain A (valine) into aspartic acid (00:06:18) [INFO] Auto_mut: Mutating residue number 83 from chain A (leucine) into glutamic acid (00:06:22) [INFO] Auto_mut: Mutating residue number 83 from chain A (leucine) into aspartic acid (00:06:31) [INFO] Auto_mut: Mutating residue number 120 from chain A (valine) into arginine (00:07:40) [INFO] Auto_mut: Mutating residue number 83 from chain A (leucine) into lysine (00:07:45) [INFO] Auto_mut: Mutating residue number 83 from chain A (leucine) into arginine (00:07:57) [INFO] Auto_mut: Mutating residue number 127 from chain A (leucine) into glutamic acid (00:09:06) [INFO] Auto_mut: Mutating residue number 127 from chain A (leucine) into aspartic acid (00:09:09) [INFO] Auto_mut: Mutating residue number 59 from chain A (isoleucine) into glutamic acid (00:09:19) [INFO] Auto_mut: Mutating residue number 127 from chain A (leucine) into lysine (00:10:37) [INFO] Auto_mut: Mutating residue number 127 from chain A (leucine) into arginine (00:10:43) [INFO] Auto_mut: Mutating residue number 59 from chain A (isoleucine) into lysine (00:10:47) [INFO] Auto_mut: Mutating residue number 59 from chain A (isoleucine) into aspartic acid (00:12:18) [INFO] Auto_mut: Mutating residue number 46 from chain A (phenylalanine) into glutamic acid Mutating residue number 46 from chain A (phenylalanine) into glutamic acid (00:12:19) [INFO] Auto_mut: Mutating residue number 46 from chain A (phenylalanine) into aspartic acid Mutating residue number 46 from chain A (phenylalanine) into aspartic acid (00:12:38) [INFO] Auto_mut: Mutating residue number 59 from chain A (isoleucine) into arginine (00:13:46) [INFO] Auto_mut: Mutating residue number 46 from chain A (phenylalanine) into lysine (00:14:10) [INFO] Auto_mut: Mutating residue number 46 from chain A (phenylalanine) into arginine (00:14:25) [INFO] Auto_mut: Effect of mutation residue number 32 from chain A (leucine) into glutamic acid: Energy difference: 1.1957 kcal/mol, Difference in average score from the base case: -0.0279 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 32 from chain A (leucine) into lysine: Energy difference: -0.2172 kcal/mol, Difference in average score from the base case: -0.0258 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 32 from chain A (leucine) into aspartic acid: Energy difference: 1.3714 kcal/mol, Difference in average score from the base case: -0.0142 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 32 from chain A (leucine) into arginine: Energy difference: -0.4019 kcal/mol, Difference in average score from the base case: -0.0271 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 120 from chain A (valine) into glutamic acid: Energy difference: -0.7751 kcal/mol, Difference in average score from the base case: -0.0304 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 120 from chain A (valine) into lysine: Energy difference: -1.0029 kcal/mol, Difference in average score from the base case: -0.0290 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 120 from chain A (valine) into aspartic acid: Energy difference: -0.6348 kcal/mol, Difference in average score from the base case: -0.0298 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 120 from chain A (valine) into arginine: Energy difference: -0.8010 kcal/mol, Difference in average score from the base case: -0.0293 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 83 from chain A (leucine) into glutamic acid: Energy difference: 0.7557 kcal/mol, Difference in average score from the base case: -0.0263 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 83 from chain A (leucine) into lysine: Energy difference: 0.0171 kcal/mol, Difference in average score from the base case: -0.0254 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 83 from chain A (leucine) into aspartic acid: Energy difference: 1.1833 kcal/mol, Difference in average score from the base case: -0.0262 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 83 from chain A (leucine) into arginine: Energy difference: 0.2037 kcal/mol, Difference in average score from the base case: -0.0261 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 127 from chain A (leucine) into glutamic acid: Energy difference: 0.7903 kcal/mol, Difference in average score from the base case: -0.0174 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 127 from chain A (leucine) into lysine: Energy difference: 0.4148 kcal/mol, Difference in average score from the base case: -0.0235 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 127 from chain A (leucine) into aspartic acid: Energy difference: 1.3267 kcal/mol, Difference in average score from the base case: -0.0206 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 127 from chain A (leucine) into arginine: Energy difference: 0.6074 kcal/mol, Difference in average score from the base case: -0.0248 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 59 from chain A (isoleucine) into glutamic acid: Energy difference: 0.0139 kcal/mol, Difference in average score from the base case: -0.0248 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 59 from chain A (isoleucine) into lysine: Energy difference: 0.0613 kcal/mol, Difference in average score from the base case: -0.0219 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 59 from chain A (isoleucine) into aspartic acid: Energy difference: 0.8227 kcal/mol, Difference in average score from the base case: -0.0256 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 59 from chain A (isoleucine) into arginine: Energy difference: 0.2935 kcal/mol, Difference in average score from the base case: -0.0203 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 46 from chain A (phenylalanine) into glutamic acid: Energy difference: 1.9462 kcal/mol, Difference in average score from the base case: -0.0206 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 46 from chain A (phenylalanine) into lysine: Energy difference: 0.0177 kcal/mol, Difference in average score from the base case: -0.0210 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 46 from chain A (phenylalanine) into aspartic acid: Energy difference: 2.4024 kcal/mol, Difference in average score from the base case: -0.0275 (00:16:00) [INFO] Auto_mut: Effect of mutation residue number 46 from chain A (phenylalanine) into arginine: Energy difference: -0.1348 kcal/mol, Difference in average score from the base case: -0.0150 (00:16:00) [INFO] Main: Simulation completed successfully. (00:16:05) |
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan3D score | mutation |
---|---|---|---|---|
residue index | residue name | chain | Aggrescan3D score | |
1 | T | A | -0.2715 | |
2 | Q | A | -1.5150 | |
3 | K | A | -1.9974 | |
4 | G | A | -0.9887 | |
5 | Q | A | -1.5841 | |
6 | K | A | -2.1415 | |
7 | N | A | -1.5882 | |
8 | S | A | -0.3508 | |
9 | K | A | -0.4391 | |
10 | T | A | -0.3242 | |
11 | Q | A | -1.2046 | |
12 | I | A | 0.0000 | |
13 | V | A | 0.0000 | |
14 | E | A | -1.8579 | |
15 | S | A | -0.5042 | |
16 | V | A | -0.1765 | |
17 | E | A | -1.7441 | |
18 | I | A | -0.1214 | |
19 | S | A | -0.4105 | |
20 | E | A | -2.2410 | |
21 | E | A | -2.0275 | |
22 | L | A | 0.2361 | |
23 | K | A | -0.9849 | |
24 | K | A | -1.8185 | |
25 | C | A | 0.1612 | |
26 | L | A | 0.0000 | |
27 | E | A | -1.4580 | |
28 | E | A | -2.1499 | |
29 | K | A | -1.1540 | |
30 | L | A | 0.0000 | |
31 | A | A | 0.3571 | |
32 | L | A | 1.4477 | |
33 | E | A | -0.3118 | |
34 | T | A | -0.2357 | |
35 | G | A | -0.6375 | |
36 | E | A | -1.9173 | |
37 | K | A | -0.5696 | |
38 | F | A | 0.0000 | |
39 | K | A | -1.6776 | |
40 | K | A | -0.4793 | |
41 | L | A | 0.0000 | |
42 | D | A | -0.3828 | |
43 | D | A | 0.0000 | |
44 | Y | A | 0.0000 | |
45 | L | A | 0.0000 | |
46 | F | A | 0.9557 | |
47 | E | A | 0.0000 | |
48 | R | A | -1.8491 | |
49 | D | A | 0.0000 | |
50 | G | A | -0.2999 | |
51 | H | A | -0.5384 | |
52 | R | A | -1.1766 | |
53 | C | A | 0.0000 | |
54 | I | A | 0.0000 | |
55 | Y | A | 0.0000 | |
56 | S | A | -0.0935 | |
57 | G | A | -0.2879 | |
58 | Q | A | -0.8294 | |
59 | I | A | 1.0318 | |
60 | I | A | 0.0000 | |
61 | N | A | -1.2334 | |
62 | I | A | -0.0558 | |
63 | S | A | -0.2268 | |
64 | Q | A | -0.5118 | |
65 | L | A | 0.0000 | |
66 | L | A | -0.1263 | |
67 | D | A | -2.1103 | |
68 | D | A | -2.2032 | |
69 | G | A | -0.7227 | |
70 | L | A | 0.2723 | |
71 | V | A | 0.0000 | |
72 | D | A | -0.5962 | |
73 | I | A | 0.1911 | |
74 | E | A | 0.0000 | |
75 | H | A | -0.1472 | |
76 | I | A | 0.0000 | |
77 | I | A | 0.0000 | |
78 | P | A | 0.0000 | |
79 | R | A | -1.6971 | |
80 | S | A | -0.5620 | |
81 | R | A | 0.0000 | |
82 | S | A | 0.1727 | |
83 | L | A | 1.2483 | |
84 | D | A | -0.3873 | |
85 | D | A | -1.7913 | |
86 | S | A | -0.5576 | |
87 | R | A | -0.8232 | |
88 | N | A | -0.7207 | |
89 | N | A | 0.0000 | |
90 | K | A | -0.2762 | |
91 | V | A | 0.0000 | |
92 | L | A | 0.0000 | |
93 | C | A | 0.0000 | |
94 | Y | A | 0.0000 | |
95 | A | A | 0.0000 | |
96 | E | A | -0.7972 | |
97 | M | A | 0.0222 | |
98 | N | A | -0.5093 | |
99 | R | A | -2.1890 | |
100 | K | A | -1.9831 | |
101 | K | A | 0.0000 | |
102 | G | A | -0.6707 | |
103 | D | A | -1.9165 | |
104 | Q | A | -0.6787 | |
105 | T | A | 0.0000 | |
106 | A | A | 0.0000 | |
107 | Y | A | 0.0959 | |
108 | D | A | -0.3988 | |
109 | Y | A | 0.0000 | |
110 | I | A | 0.0000 | |
111 | V | A | 0.3276 | |
112 | S | A | -0.3722 | |
113 | K | A | -1.6612 | |
114 | R | A | -2.3048 | |
115 | N | A | -1.6237 | |
116 | G | A | -0.7560 | |
117 | E | A | -1.8329 | |
118 | M | A | -0.2366 | |
119 | S | A | 0.3242 | |
120 | V | A | 1.2893 | |
121 | E | A | -1.4791 | |
122 | L | A | 0.0000 | |
123 | R | A | -1.3312 | |
124 | T | A | -0.3976 | |
125 | R | A | -0.4179 | |
126 | V | A | 0.0000 | |
127 | L | A | 1.2122 | |
128 | E | A | -1.5279 | |
129 | L | A | -0.3613 | |
130 | Q | A | -1.1769 | |
131 | G | A | -0.4324 | |
132 | M | A | 0.0405 | |
133 | G | A | -0.5711 | |
134 | K | A | -1.7163 | |
135 | A | A | -0.2879 | |
136 | K | A | 0.0000 | |
137 | Y | A | -0.1948 | |
138 | K | A | -1.6977 | |
139 | K | A | -0.5784 | |
140 | L | A | 0.0000 | |
141 | L | A | 0.3896 | |
142 | K | A | -0.3562 | |
143 | T | A | -0.2716 | |
144 | E | A | -0.9587 | |
145 | S | A | -0.7114 | |
146 | D | A | -1.8280 | |
147 | I | A | 0.0000 | |
148 | P | A | -0.4133 | |
149 | E | A | -1.8554 | |
150 | G | A | -0.5005 | |
151 | F | A | 0.6162 | |
152 | I | A | -0.1532 | |
153 | D | A | -2.0761 | |
154 | R | A | -2.3670 | |
155 | D | A | -1.7792 | |
156 | L | A | 0.8875 | |
157 | R | A | -1.7886 | |
158 | N | A | -1.6012 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
VK120A | -1.0029 | -0.029 | View | CSV | PDB |
VE120A | -0.7751 | -0.0304 | View | CSV | PDB |
LR32A | -0.4019 | -0.0271 | View | CSV | PDB |
LK32A | -0.2172 | -0.0258 | View | CSV | PDB |
FR46A | -0.1348 | -0.015 | View | CSV | PDB |
IE59A | 0.0139 | -0.0248 | View | CSV | PDB |
LK83A | 0.0171 | -0.0254 | View | CSV | PDB |
FK46A | 0.0177 | -0.021 | View | CSV | PDB |
IK59A | 0.0613 | -0.0219 | View | CSV | PDB |
LR83A | 0.2037 | -0.0261 | View | CSV | PDB |
LK127A | 0.4148 | -0.0235 | View | CSV | PDB |
LR127A | 0.6074 | -0.0248 | View | CSV | PDB |