Project name: B02

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDWDWPWLTELDYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.9546
• Maximal score value: 1.7206
• Average score: -0.6777
• Total score value: -93.5176

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9087
2	V	A	-0.8112
3	Q	A	-0.7114
4	L	A	0.0000
5	V	A	1.2106
6	E	A	0.4004
7	S	A	-0.2574
8	G	A	-0.8758
9	G	A	0.1128
10	G	A	0.6914
11	L	A	1.4946
12	V	A	0.1608
13	Q	A	-0.9563
14	P	A	-1.5016
15	G	A	-1.3576
16	G	A	-0.7887
17	S	A	-1.1947
18	L	A	-0.9193
19	R	A	-2.1486
20	L	A	0.0000
21	S	A	-0.4028
22	C	A	0.0000
23	A	A	-0.0138
24	A	A	-0.3959
25	S	A	-0.8624
26	G	A	-1.3400
27	F	A	-1.4919
28	R	A	-2.9546
29	I	A	0.0000
30	S	A	-2.1899
31	D	A	-2.6901
32	E	A	-1.6318
33	D	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4790
40	A	A	-1.0292
41	P	A	-1.1277
42	G	A	-1.5873
43	K	A	-2.1358
44	G	A	-0.9764
45	L	A	0.5356
46	E	A	-0.3320
47	W	A	0.2902
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	-0.2534
53	G	A	-1.3209
54	P	A	-1.0168
55	S	A	-0.6565
56	G	A	-0.5191
57	S	A	-0.0406
58	T	A	0.4684
59	Y	A	0.8296
60	Y	A	-0.2530
61	A	A	-1.0618
62	D	A	-2.2710
63	S	A	-1.7268
64	V	A	0.0000
65	K	A	-2.4210
66	G	A	-1.7066
67	R	A	-1.2467
68	F	A	0.0000
69	T	A	-0.7092
70	I	A	0.0000
71	S	A	-0.5248
72	R	A	-1.1717
73	D	A	-1.8228
74	N	A	-2.8485
75	S	A	-2.0977
76	K	A	-2.6849
77	N	A	-2.2658
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6217
81	L	A	0.0000
82	Q	A	-1.2897
83	M	A	0.0000
84	N	A	-1.5109
85	S	A	-1.3251
86	L	A	0.0000
87	R	A	-2.7982
88	A	A	-1.9045
89	E	A	-2.4523
90	D	A	0.0000
91	T	A	-0.4914
92	A	A	0.0000
93	V	A	0.9152
94	Y	A	0.0000
95	Y	A	0.5907
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.0000
99	D	A	-0.5514
100	W	A	0.0526
101	D	A	-0.3716
102	W	A	1.1161
103	P	A	1.0732
104	W	A	1.6928
105	L	A	1.7206
106	T	A	-0.0107
107	E	A	-1.5739
108	L	A	-1.0746
109	D	A	-1.7279
110	Y	A	-0.3591
111	W	A	0.1334
112	G	A	0.0000
113	Q	A	-0.7917
114	G	A	0.1138
115	T	A	0.6267
116	L	A	1.7192
117	V	A	0.0000
118	T	A	0.4775
119	V	A	0.0000
120	S	A	-0.6648
121	S	A	-0.6284
122	G	A	-0.6602
123	P	A	-0.7876
124	G	A	-0.6797
125	G	A	-0.9492
126	Q	A	-1.2803
127	L	A	0.0768
128	P	A	-0.9222
129	E	A	-1.9451
130	T	A	-1.3017
131	G	A	-1.7217
132	G	A	-1.8470
133	H	A	-2.2108
134	H	A	-2.5128
135	H	A	-2.6362
136	H	A	-2.5761
137	H	A	-2.3249
138	H	A	-1.8257