Project name: G07

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYDWAWADYWGQGTLVTVSSGPGGQLPETGGHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.9692
• Maximal score value: 1.687
• Average score: -0.6867
• Total score value: -92.7088

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9235
2	V	A	-0.7995
3	Q	A	-0.6936
4	L	A	0.0000
5	V	A	1.2161
6	E	A	0.4951
7	S	A	-0.2553
8	G	A	-0.6951
9	G	A	0.0836
10	G	A	0.6067
11	L	A	1.2751
12	V	A	0.0613
13	Q	A	-1.0138
14	P	A	-1.5245
15	G	A	-1.3682
16	G	A	-0.8166
17	S	A	-1.1825
18	L	A	-0.9221
19	R	A	-2.1318
20	L	A	0.0000
21	S	A	-0.3990
22	C	A	0.0000
23	A	A	-0.0125
24	A	A	-0.5159
25	S	A	-0.8834
26	G	A	-1.3607
27	F	A	-1.5147
28	R	A	-2.9692
29	I	A	0.0000
30	S	A	-2.3348
31	D	A	-2.8765
32	E	A	-1.8437
33	D	A	-1.0523
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4889
40	A	A	-1.0309
41	P	A	-1.3159
42	G	A	-1.5902
43	K	A	-2.1269
44	G	A	-1.0048
45	L	A	0.5446
46	E	A	-0.2963
47	W	A	0.4547
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	Y	A	0.0000
53	G	A	-1.5853
54	P	A	-1.2436
55	S	A	-0.8414
56	G	A	-0.7503
57	S	A	-0.2592
58	T	A	0.2415
59	Y	A	0.5873
60	Y	A	-0.3355
61	A	A	0.0000
62	D	A	-2.3570
63	S	A	-1.7334
64	V	A	0.0000
65	K	A	-2.4467
66	G	A	-1.7028
67	R	A	-1.4211
68	F	A	0.0000
69	T	A	-0.7119
70	I	A	0.0000
71	S	A	-0.5133
72	R	A	-1.1528
73	D	A	-1.8002
74	N	A	-2.8125
75	S	A	-2.0813
76	K	A	-2.6700
77	N	A	-2.2542
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6113
81	L	A	0.0000
82	Q	A	-1.2304
83	M	A	0.0000
84	N	A	-1.4815
85	S	A	-1.3151
86	L	A	0.0000
87	R	A	-2.8023
88	A	A	-1.9056
89	E	A	-2.4809
90	D	A	0.0000
91	T	A	-0.5155
92	A	A	0.0000
93	V	A	0.9119
94	Y	A	0.0000
95	Y	A	0.6011
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.0178
99	D	A	0.0000
100	Y	A	0.3251
101	D	A	-0.6169
102	W	A	0.8221
103	A	A	0.8194
104	W	A	1.1072
105	A	A	0.4773
106	D	A	-0.0439
107	Y	A	0.4946
108	W	A	0.4139
109	G	A	0.0000
110	Q	A	-0.7727
111	G	A	0.1291
112	T	A	0.6207
113	L	A	1.6870
114	V	A	0.0000
115	T	A	0.4068
116	V	A	0.0000
117	S	A	-0.7567
118	S	A	-0.6649
119	G	A	-0.6887
120	P	A	-0.8265
121	G	A	-0.7196
122	G	A	-0.9804
123	Q	A	-1.3022
124	L	A	0.0823
125	P	A	-0.9261
126	E	A	-1.9554
127	T	A	-1.3032
128	G	A	-1.7260
129	G	A	-1.8469
130	H	A	-2.2126
131	H	A	-2.5188
132	H	A	-2.6408
133	H	A	-2.5774
134	H	A	-2.3295
135	H	A	-1.8237