Project name: 1mfg bound default A EYLGLDVPV ss: CCCCCCEEC

Status: done

submitted: 2015-02-19 18:28:15, status changed: 2015-03-13 10:49:57

Project settings
Protein sequence(s) GSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS input pdb
Peptide sequence EYLGLDVPV
Simulation mc cycles50
Peptide secondary structure CCCCCCEEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.1189 3.58123 18.282 158
cluster_2.pdb ( medoid) 29.9931 7.73511 28.8655 232
cluster_3.pdb ( medoid) 22.5338 4.92593 18.2312 111
cluster_4.pdb ( medoid) 22.4038 5.4455 19.3661 122
cluster_5.pdb ( medoid) 13.1083 7.17103 26.2094 94
cluster_6.pdb ( medoid) 10.1911 7.45749 20.8604 76
cluster_7.pdb ( medoid) 8.70897 8.26734 19.0584 72
cluster_8.pdb ( medoid) 6.43086 7.153 18.5997 46
cluster_9.pdb ( medoid) 4.95753 11.296 24.2357 56
cluster_10.pdb ( medoid) 2.7371 12.0565 30.9587 33
Laboratory of Theory of Biopolymers 2015