Project name: 2LNS_A1

Status: done

submitted: 2018-10-11 13:50:46, status changed: 2018-10-12 00:10:43

Project settings
Protein sequence(s) IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL input pdb
Peptide sequence FPTIYYFS
Simulation mc cycles150
Peptide secondary structure CCCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.6386 2.58375 9.3459 105
cluster_2.pdb ( medoid) 23.3616 6.93446 19.3814 162
cluster_3.pdb ( medoid) 19.3285 8.2262 22.2092 159
cluster_4.pdb ( medoid) 17.9503 6.01661 25.0278 108
cluster_5.pdb ( medoid) 17.8323 6.44896 19.4956 115
cluster_6.pdb ( medoid) 17.7834 6.74786 30.6143 120
cluster_7.pdb ( medoid) 15.7358 4.44845 10.5202 70
cluster_8.pdb ( medoid) 10.3838 6.64499 17.2702 69
cluster_9.pdb ( medoid) 10.1384 6.50988 29.2684 66
cluster_10.pdb ( medoid) 4.42498 5.87573 10.9573 26

 
Laboratory of Theory of Biopolymers 2015