Project name: 2fmf bound default 2 runA QDQVDDLLDSLGF ss: CHHHHHHHHHHCC

Status: done

submitted: 2015-02-23 11:18:39, status changed: 2015-03-13 10:51:55

Project settings
Protein sequence(s) ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM input pdb
Peptide sequence QDQVDDLLDSLGF
Simulation mc cycles50
Peptide secondary structure CHHHHHHHHHHCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.5556 2.57865 27.7149 102
cluster_2.pdb ( medoid) 31.2752 4.15665 17.9202 130
cluster_3.pdb ( medoid) 31.2627 5.02196 18.5279 157
cluster_4.pdb ( medoid) 22.8392 4.11574 13.9011 94
cluster_5.pdb ( medoid) 20.4863 5.36943 13.6768 110
cluster_6.pdb ( medoid) 13.6811 6.06675 35.9059 83
cluster_7.pdb ( medoid) 11.7247 10.6613 29.7073 125
cluster_8.pdb ( medoid) 5.69448 11.7658 30.8912 67
cluster_9.pdb ( medoid) 5.30084 11.319 30.5589 60
cluster_10.pdb ( medoid) 4.99091 14.4262 28.9599 72
Laboratory of Theory of Biopolymers 2015