Project name: 2H3L unbound default A EYLGLDVPV ss: CCCCCCCCC

Status: done

submitted: 2015-02-20 17:44:36, status changed: 2015-03-13 10:52:21

Project settings
Protein sequence(s) GSHMGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS input pdb
Peptide sequence EYLGLDVPV
Simulation mc cycles50
Peptide secondary structure CCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.5577 5.08785 31.6417 186
cluster_2.pdb ( medoid) 31.9751 3.94057 14.5806 126
cluster_3.pdb ( medoid) 27.3392 4.27958 12.0606 117
cluster_4.pdb ( medoid) 17.8941 4.41485 13.7431 79
cluster_5.pdb ( medoid) 11.9083 10.4129 24.6133 124
cluster_6.pdb ( medoid) 11.0787 10.2901 24.6837 114
cluster_7.pdb ( medoid) 10.4355 7.37868 19.1643 77
cluster_8.pdb ( medoid) 7.5279 8.36887 30.0025 63
cluster_9.pdb ( medoid) 7.37896 9.62196 29.7861 71
cluster_10.pdb ( medoid) 3.16614 13.5812 32.7009 43
Laboratory of Theory of Biopolymers 2015