Project name: 1n7f bound default B ATVRTYSC ss: CCCEEEEC

Status: done

submitted: 2015-02-19 18:28:15, status changed: 2015-03-13 10:53:57

Project settings
Protein sequence(s) AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ input pdb
Peptide sequence ATVRTYSC
Simulation mc cycles50
Peptide secondary structure CCCEEEEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.655 3.52645 12.837 161
cluster_2.pdb ( medoid) 42.2399 3.38543 20.7263 143
cluster_3.pdb ( medoid) 31.1494 4.36606 24.8832 136
cluster_4.pdb ( medoid) 16.281 7.06345 24.8104 115
cluster_5.pdb ( medoid) 7.6932 10.6588 27.1965 82
cluster_6.pdb ( medoid) 7.6675 10.8249 27.6874 83
cluster_7.pdb ( medoid) 6.52564 9.65422 20.4055 63
cluster_8.pdb ( medoid) 5.70009 11.4033 27.6853 65
cluster_9.pdb ( medoid) 5.66044 13.7798 34.6019 78
cluster_10.pdb ( medoid) 5.13944 14.3984 34 74
Laboratory of Theory of Biopolymers 2015