Project name: 1d4t bound default A KSLTIYAQVQK ss: CCCEEEECECC

Status: done

submitted: 2015-02-19 18:28:11, status changed: 2015-03-13 10:54:00

Project settings
Protein sequence(s) MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK input pdb
Peptide sequence KSLTIYAQVQK
Simulation mc cycles50
Peptide secondary structure CCCEEEECECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 79.3237 1.3363 15.361 106
cluster_2.pdb ( medoid) 47.8021 5.83656 26.4778 279
cluster_3.pdb ( medoid) 20.7969 4.23141 20.1735 88
cluster_4.pdb ( medoid) 18.3916 6.14411 26.1942 113
cluster_5.pdb ( medoid) 15.9027 4.40178 10.905 70
cluster_6.pdb ( medoid) 14.1612 8.05018 24.8163 114
cluster_7.pdb ( medoid) 12.0399 6.64458 19.7122 80
cluster_8.pdb ( medoid) 5.66197 12.1866 31.5942 69
cluster_9.pdb ( medoid) 3.76641 13.0097 23.4513 49
cluster_10.pdb ( medoid) 2.05485 15.5729 30.3811 32
Laboratory of Theory of Biopolymers 2015