Project name: 296d7b44fe3410b

Status: done

submitted: 2017-12-06 06:04:08, status changed: 2017-12-06 09:01:51

Project settings
Protein sequence(s) APVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGSNAKAQDLGTIPGDCGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEALEFQ input pdb
Peptide sequence ADARYKS
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.5089 2.67413 30.3723 111
cluster_2.pdb ( medoid) 40.3925 3.8621 12.4038 156
cluster_3.pdb ( medoid) 31.0191 4.06201 19.5014 126
cluster_4.pdb ( medoid) 22.5263 6.25936 14.3205 141
cluster_5.pdb ( medoid) 15.5658 6.55282 25.0269 102
cluster_6.pdb ( medoid) 12.0051 9.24607 29.6944 111
cluster_7.pdb ( medoid) 8.27033 15.8398 43.8977 131
cluster_8.pdb ( medoid) 2.86904 17.4274 39.1351 50
cluster_9.pdb ( medoid) 2.70709 11.4514 31.5124 31
cluster_10.pdb ( medoid) 2.65178 15.4613 41.0045 41

 
Laboratory of Theory of Biopolymers 2015