Project name: 2974a25ff79b99

Status: done

submitted: 2017-12-06 06:01:43, status changed: 2017-12-06 09:02:40

Project settings
Protein sequence(s) APVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGSNAKAQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEALEFQ input pdb
Peptide sequence ADARYKS
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 58.4599 3.09614 24.386 181
cluster_2.pdb ( medoid) 24.7276 6.71315 27.7153 166
cluster_3.pdb ( medoid) 14.7536 10.3026 31.3752 152
cluster_4.pdb ( medoid) 8.59889 12.0946 37.5215 104
cluster_5.pdb ( medoid) 8.25197 13.5725 42.6414 112
cluster_6.pdb ( medoid) 7.30139 4.65665 18.9764 34
cluster_7.pdb ( medoid) 7.2965 11.1012 25.7731 81
cluster_8.pdb ( medoid) 6.66215 11.7079 26.8347 78
cluster_9.pdb ( medoid) 5.31704 8.65143 30.3232 46
cluster_10.pdb ( medoid) 5.11978 8.98476 25.0082 46

 
Laboratory of Theory of Biopolymers 2015