Project name: 2d0n bound default C PSIDRSTKP ss: CCCCHHHCC

Status: done

submitted: 2015-02-19 18:28:25, status changed: 2015-03-13 10:54:14

Project settings
Protein sequence(s) PWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM input pdb
Peptide sequence PSIDRSTKP
Simulation mc cycles50
Peptide secondary structure CCCCHHHCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.2714 5.31855 17.6494 161
cluster_2.pdb ( medoid) 28.3728 7.01376 28.3346 199
cluster_3.pdb ( medoid) 26.3794 5.23135 22.1975 138
cluster_4.pdb ( medoid) 18.0653 5.48012 20.6746 99
cluster_5.pdb ( medoid) 12.9348 7.18992 29.1496 93
cluster_6.pdb ( medoid) 11.2552 4.35353 8.20913 49
cluster_7.pdb ( medoid) 10.6844 11.7928 29.5663 126
cluster_8.pdb ( medoid) 7.15272 10.0661 25.0593 72
cluster_9.pdb ( medoid) 4.23632 8.97004 21.3956 38
cluster_10.pdb ( medoid) 1.66614 15.0048 28.4944 25
Laboratory of Theory of Biopolymers 2015