Project name: 2F1W unbound default A GARAHSS ss: CCCCECC

Status: done

submitted: 2015-02-20 17:44:45, status changed: 2015-03-13 10:54:49

Project settings
Protein sequence(s) TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWD input pdb
Peptide sequence GARAHSS
Simulation mc cycles50
Peptide secondary structure CCCCECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.6952 5.01765 13.4434 149
cluster_2.pdb ( medoid) 27.318 3.00168 9.10373 82
cluster_3.pdb ( medoid) 23.797 8.02621 26.3538 191
cluster_4.pdb ( medoid) 21.6934 5.80821 27.68 126
cluster_5.pdb ( medoid) 13.364 10.7004 31.8087 143
cluster_6.pdb ( medoid) 12.171 6.40867 18.8768 78
cluster_7.pdb ( medoid) 11.7437 8.34493 20.606 98
cluster_8.pdb ( medoid) 6.00756 10.3203 20.6831 62
cluster_9.pdb ( medoid) 5.82816 7.89272 20.5708 46
cluster_10.pdb ( medoid) 1.976 12.6518 26.1742 25
Laboratory of Theory of Biopolymers 2015