Project name: 1gyb bound default B GFSFG ss: CCCCC

Status: done

submitted: 2015-02-19 18:28:12, status changed: 2015-03-13 10:56:52

Project settings
Protein sequence(s) LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYS input pdb
Peptide sequence GFSFG
Simulation mc cycles50
Peptide secondary structure CCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 106.766 0.590074 4.51536 63
cluster_2.pdb ( medoid) 87.0413 0.838682 3.58971 73
cluster_3.pdb ( medoid) 56.9566 1.36946 22.455 78
cluster_4.pdb ( medoid) 35.7677 5.42389 32.1052 194
cluster_5.pdb ( medoid) 33.216 3.5224 7.89726 117
cluster_6.pdb ( medoid) 27.8893 6.23895 27.5162 174
cluster_7.pdb ( medoid) 24.9988 1.92009 19.7575 48
cluster_8.pdb ( medoid) 12.3447 11.5029 31.9323 142
cluster_9.pdb ( medoid) 6.0372 11.9261 28.3224 72
cluster_10.pdb ( medoid) 2.44976 15.9199 34.4052 39
Laboratory of Theory of Biopolymers 2015