Project name: 2IOG unbound default 2 run A KILHRLLQD ss: CHHHHHHHC

Status: done

submitted: 2015-02-25 18:46:53, status changed: 2015-03-13 10:57:02

Project settings
Protein sequence(s) SLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA input pdb
Peptide sequence KILHRLLQD
Simulation mc cycles50
Peptide secondary structure CHHHHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 50.6974 3.70828 13.7188 188
cluster_2.pdb ( medoid) 49.5544 2.62338 8.85543 130
cluster_3.pdb ( medoid) 44.9621 2.51323 12.4673 113
cluster_4.pdb ( medoid) 27.3777 5.40587 20.2188 148
cluster_5.pdb ( medoid) 13.4437 6.17388 28.0051 83
cluster_6.pdb ( medoid) 12.3764 10.5038 30.4455 130
cluster_7.pdb ( medoid) 10.1739 8.15815 29.5253 83
cluster_8.pdb ( medoid) 5.06771 7.30112 16.1383 37
cluster_9.pdb ( medoid) 4.38392 5.70265 11.704 25
cluster_10.pdb ( medoid) 4.05026 15.5546 48.2073 63
Laboratory of Theory of Biopolymers 2015