Project name: 1GY7 unbound default 2 run B GFSFG ss: CCCCC

Status: done

submitted: 2015-02-25 18:46:46, status changed: 2015-03-13 10:57:18

Project settings
Protein sequence(s) LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYS input pdb
Peptide sequence GFSFG
Simulation mc cycles50
Peptide secondary structure CCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.9597 3.14588 31.0505 132
cluster_2.pdb ( medoid) 32.7316 4.39942 36.4061 144
cluster_3.pdb ( medoid) 30.4671 3.15094 20.0701 96
cluster_4.pdb ( medoid) 28.7096 4.45844 15.4848 128
cluster_5.pdb ( medoid) 16.6892 6.17167 23.3316 103
cluster_6.pdb ( medoid) 12.6652 9.79062 24.1113 124
cluster_7.pdb ( medoid) 11.9264 8.04935 19.4547 96
cluster_8.pdb ( medoid) 7.29879 8.76857 23.1075 64
cluster_9.pdb ( medoid) 4.95003 12.9292 28.1727 64
cluster_10.pdb ( medoid) 3.47765 14.09 31.8668 49
Laboratory of Theory of Biopolymers 2015