Project name: 3faf0b601f4ca72

Status: done

submitted: 2018-10-12 07:46:59, status changed: 2018-10-12 09:05:34

Project settings
Protein sequence(s) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY input pdb
Peptide sequence ANPTFFS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.6238 3.38384 18.3432 151
cluster_2.pdb ( medoid) 26.4984 5.0569 19.9461 134
cluster_3.pdb ( medoid) 23.1002 5.32462 15.8265 123
cluster_4.pdb ( medoid) 22.7514 3.60417 13.0027 82
cluster_5.pdb ( medoid) 20.7107 7.33919 21.0651 152
cluster_6.pdb ( medoid) 9.12526 11.2874 30.2362 103
cluster_7.pdb ( medoid) 9.11824 6.58022 22.3094 60
cluster_8.pdb ( medoid) 8.3003 6.86722 20.5266 57
cluster_9.pdb ( medoid) 6.48983 9.86159 25.9971 64
cluster_10.pdb ( medoid) 5.28735 13.9957 31.2013 74

 
Laboratory of Theory of Biopolymers 2015