Project name: 1nln bound default 3 runA GVQSLKRRRCF ss: CCCEEEEEEEC

Status: done

submitted: 2015-02-23 11:19:02, status changed: 2015-03-13 10:58:32

Project settings
Protein sequence(s) GSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM input pdb
Peptide sequence GVQSLKRRRCF
Simulation mc cycles50
Peptide secondary structure CCCEEEEEEEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.7379 4.66283 13.4497 134
cluster_2.pdb ( medoid) 26.2284 4.46081 20.5615 117
cluster_3.pdb ( medoid) 22.4429 11.8077 36.5597 265
cluster_4.pdb ( medoid) 7.75851 13.1469 42.9314 102
cluster_5.pdb ( medoid) 7.09462 14.7999 33.1447 105
cluster_6.pdb ( medoid) 6.8187 9.97257 23.8459 68
cluster_7.pdb ( medoid) 6.67992 5.98809 19.4447 40
cluster_8.pdb ( medoid) 5.59141 11.2673 27.6355 63
cluster_9.pdb ( medoid) 3.80465 15.5073 35.8031 59
cluster_10.pdb ( medoid) 3.28372 14.3131 34.0029 47
Laboratory of Theory of Biopolymers 2015