Project name: 1N83 unbound default 3 run A HKILHRLLQE ss: CHHHHHHHHC

Status: done

submitted: 2015-02-25 18:47:32, status changed: 2015-03-13 10:58:37

Project settings
Protein sequence(s) HHLEVLFQGPAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELF input pdb
Peptide sequence HKILHRLLQE
Simulation mc cycles50
Peptide secondary structure CHHHHHHHHC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.819 5.44391 26.2773 146
cluster_2.pdb ( medoid) 26.7716 3.88471 22.292 104
cluster_3.pdb ( medoid) 26.5374 7.53653 33.6516 200
cluster_4.pdb ( medoid) 20.7477 6.84414 22.1295 142
cluster_5.pdb ( medoid) 13.9429 6.88522 17.6171 96
cluster_6.pdb ( medoid) 10.2571 4.97217 21.5208 51
cluster_7.pdb ( medoid) 6.60427 13.0219 41.1346 86
cluster_8.pdb ( medoid) 5.92208 15.0285 31.8443 89
cluster_9.pdb ( medoid) 5.12975 11.3066 24.0607 58
cluster_10.pdb ( medoid) 2.33604 11.9861 32.4207 28
Laboratory of Theory of Biopolymers 2015