Project name: 1lvm bound default 2 runA EATQLMN ss: CCEECCC

Status: done

submitted: 2015-02-23 11:18:27, status changed: 2015-03-13 10:58:54

Project settings
Protein sequence(s) GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMDKP input pdb
Peptide sequence EATQLMN
Simulation mc cycles50
Peptide secondary structure CCEECCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.0143 4.17036 29.6805 121
cluster_2.pdb ( medoid) 23.62 4.53006 16.9038 107
cluster_3.pdb ( medoid) 17.1752 7.16149 22.1157 123
cluster_4.pdb ( medoid) 16.8652 8.41972 34.3735 142
cluster_5.pdb ( medoid) 11.6377 9.36614 25.9024 109
cluster_6.pdb ( medoid) 9.36948 13.021 26.8844 122
cluster_7.pdb ( medoid) 7.4937 10.6756 26.112 80
cluster_8.pdb ( medoid) 7.27049 10.0406 25.0564 73
cluster_9.pdb ( medoid) 7.15911 11.5936 23.1557 83
cluster_10.pdb ( medoid) 2.79744 14.2988 33.5001 40
Laboratory of Theory of Biopolymers 2015