Project name: 1h6w bound default A SLNYIIKVKE ss: CCEEEEECCC

Status: done

submitted: 2015-02-19 18:28:12, status changed: 2015-03-13 10:59:12

Project settings
Protein sequence(s) TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIHQRGGQTINGTLRINNTLTIASGGANITGTVNMTGGYIQGKRVVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGSSSNPGLPDMR input pdb
Peptide sequence SLNYIIKVKE
Simulation mc cycles50
Peptide secondary structure CCEEEEECCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.4233 1.84321 17.4854 104
cluster_2.pdb ( medoid) 50.6743 1.97339 5.93634 100
cluster_3.pdb ( medoid) 22.9801 4.43862 14.0398 102
cluster_4.pdb ( medoid) 15.7642 9.26151 30.6934 146
cluster_5.pdb ( medoid) 9.99954 4.90022 12.8272 49
cluster_6.pdb ( medoid) 6.9867 6.72706 21.7208 47
cluster_7.pdb ( medoid) 4.95539 11.099 22.5981 55
cluster_8.pdb ( medoid) 4.4741 5.36421 13.1048 24
cluster_9.pdb ( medoid) 4.20404 9.99039 19.8046 42
cluster_10.pdb ( medoid) 2.91956 10.6181 19.7519 31
Laboratory of Theory of Biopolymers 2015