Project name: 1ihj bound default 3 runA TEFCA ss: CCCEC

Status: done

submitted: 2015-02-23 11:19:00, status changed: 2015-03-13 10:59:20

Project settings
Protein sequence(s) GELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTF input pdb
Peptide sequence TEFCA
Simulation mc cycles50
Peptide secondary structure CCCEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 53.7741 3.97961 13.0729 214
cluster_2.pdb ( medoid) 30.5285 3.57043 12.9345 109
cluster_3.pdb ( medoid) 30.1017 7.14244 41.7132 215
cluster_4.pdb ( medoid) 25.4423 4.28421 18.0438 109
cluster_5.pdb ( medoid) 15.053 5.44742 17.582 82
cluster_6.pdb ( medoid) 11.8072 7.11429 19.5876 84
cluster_7.pdb ( medoid) 6.91874 9.25023 30.0064 64
cluster_8.pdb ( medoid) 4.57087 10.7201 28.3914 49
cluster_9.pdb ( medoid) 3.22423 13.9568 31.4982 45
cluster_10.pdb ( medoid) 2.6285 11.0329 22.4293 29
Laboratory of Theory of Biopolymers 2015