Project name: 4ebcfde12a260dc

Status: done

submitted: 2017-09-13 07:35:22, status changed: 2017-09-13 13:45:09

Project settings
Protein sequence(s) MHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDS input pdb
Peptide sequence SYSMEHFRWGKPVGKKRRPVKVYP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.2736 8.20855 27.3058 150
cluster_2.pdb ( medoid) 18.1699 5.99895 48.4002 109
cluster_3.pdb ( medoid) 16.5022 7.69596 27.0181 127
cluster_4.pdb ( medoid) 15.673 8.29454 20.7015 130
cluster_5.pdb ( medoid) 14.7322 6.92363 20.4265 102
cluster_6.pdb ( medoid) 12.7145 7.78639 28.976 99
cluster_7.pdb ( medoid) 3.24803 14.4703 34.6657 47
cluster_8.pdb ( medoid) 3.06159 14.3716 26.2799 44
cluster_9.pdb ( medoid) 2.96266 20.2521 40.4402 60
cluster_10.pdb ( medoid) 2.94087 13.2614 30.7128 39

 
Laboratory of Theory of Biopolymers 2015