Project name: 2otu bound default 3 runEF QQQQQQQQQQG ss: CCCCCCCCCEC

Status: done

submitted: 2015-02-23 11:19:17, status changed: 2015-03-13 11:00:19

Project settings
Protein sequence(s) MQLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVQVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAFISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGRGYVWFAYWGQGTTVTVSS input pdb
Peptide sequence QQQQQQQQQQG
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.0002 1.77777 11.3738 80
cluster_2.pdb ( medoid) 21.7726 4.73071 10.2972 103
cluster_3.pdb ( medoid) 16.0834 7.64764 29.7524 123
cluster_4.pdb ( medoid) 15.0904 6.75926 24.6241 102
cluster_5.pdb ( medoid) 14.6884 10.4845 35.175 154
cluster_6.pdb ( medoid) 12.5615 11.4636 35.7412 144
cluster_7.pdb ( medoid) 11.7081 11.7013 24.5916 137
cluster_8.pdb ( medoid) 6.75551 9.91783 30.1035 67
cluster_9.pdb ( medoid) 6.53087 3.67485 22.0464 24
cluster_10.pdb ( medoid) 4.74077 13.9218 34.1164 66
Laboratory of Theory of Biopolymers 2015