Project name: 1ntv bound default A NFDNPVYRKT ss: CEECCCCCCC

Status: done

submitted: 2015-02-19 18:28:16, status changed: 2015-03-13 11:00:38

Project settings
Protein sequence(s) GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA input pdb
Peptide sequence NFDNPVYRKT
Simulation mc cycles50
Peptide secondary structure CEECCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 59.9476 2.11852 10.158 127
cluster_2.pdb ( medoid) 30.4686 4.36515 24.5628 133
cluster_3.pdb ( medoid) 23.0936 7.40465 22.1967 171
cluster_4.pdb ( medoid) 21.0029 6.18963 31.0818 130
cluster_5.pdb ( medoid) 20.3985 4.75526 15.2184 97
cluster_6.pdb ( medoid) 12.8821 7.84032 21.8479 101
cluster_7.pdb ( medoid) 11.1799 4.56175 13.4715 51
cluster_8.pdb ( medoid) 8.47112 8.61752 16.2614 73
cluster_9.pdb ( medoid) 7.72191 9.06511 25.3102 70
cluster_10.pdb ( medoid) 5.09395 9.22664 22.6721 47
Laboratory of Theory of Biopolymers 2015