Project name: 1er8 bound default 3 runE UPFHLLVY ss: CCCCCCEC

Status: done

submitted: 2015-02-23 11:18:59, status changed: 2015-03-13 11:01:08

Project settings
Protein sequence(s) STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVDGQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK input pdb
Peptide sequence UPFHLLVY
Simulation mc cycles50
Peptide secondary structure CCCCCCEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.904 3.57811 21.1106 107
cluster_2.pdb ( medoid) 17.6866 4.01433 23.0033 71
cluster_3.pdb ( medoid) 17.645 6.68743 44.3012 118
cluster_4.pdb ( medoid) 17.5341 13.4595 43.9647 236
cluster_5.pdb ( medoid) 17.4249 8.66578 45.011 151
cluster_6.pdb ( medoid) 13.182 5.38613 18.7804 71
cluster_7.pdb ( medoid) 8.53257 12.8918 36.0548 110
cluster_8.pdb ( medoid) 7.93855 5.92048 21.3006 47
cluster_9.pdb ( medoid) 3.64444 10.9756 29.3141 40
cluster_10.pdb ( medoid) 3.53156 13.8749 40.9295 49
Laboratory of Theory of Biopolymers 2015