Project name: 1hc9 bound default 3 runA WRYYESSLLPYPD ss: CEEECCEEEEECC

Status: done

submitted: 2015-02-23 11:18:59, status changed: 2015-03-13 11:01:10

Project settings
Protein sequence(s) IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG input pdb
Peptide sequence WRYYESSLLPYPD
Simulation mc cycles50
Peptide secondary structure CEEECCEEEEECC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.2703 7.53951 28.1116 281
cluster_2.pdb ( medoid) 31.0491 5.05651 13.241 157
cluster_3.pdb ( medoid) 29.7344 6.45716 25.0656 192
cluster_4.pdb ( medoid) 9.03301 7.41724 17.2487 67
cluster_5.pdb ( medoid) 8.48013 6.01406 22.7579 51
cluster_6.pdb ( medoid) 7.88711 5.57872 11.4335 44
cluster_7.pdb ( medoid) 7.65753 8.74956 21.8557 67
cluster_8.pdb ( medoid) 7.52478 4.91709 21.5637 37
cluster_9.pdb ( medoid) 5.99808 8.16928 20.0629 49
cluster_10.pdb ( medoid) 4.83583 11.3734 27.7793 55
Laboratory of Theory of Biopolymers 2015