Project name: 2v3s bound default 3 runB GRFQVT ss: CCCEEC

Status: done

submitted: 2015-02-23 11:19:19, status changed: 2015-03-13 11:02:35

Project settings
Protein sequence(s) GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS input pdb
Peptide sequence GRFQVT
Simulation mc cycles50
Peptide secondary structure CCCEEC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 63.5254 3.69931 13.2802 235
cluster_2.pdb ( medoid) 22.8338 6.17505 23.1355 141
cluster_3.pdb ( medoid) 21.5573 7.56126 29.1382 163
cluster_4.pdb ( medoid) 20.3382 4.13016 15.9534 84
cluster_5.pdb ( medoid) 11.4588 5.32343 23.5453 61
cluster_6.pdb ( medoid) 8.08935 11.0021 29.1856 89
cluster_7.pdb ( medoid) 7.4942 7.33901 27.3954 55
cluster_8.pdb ( medoid) 7.29969 7.53456 27.5388 55
cluster_9.pdb ( medoid) 4.98766 13.6336 35.5395 68
cluster_10.pdb ( medoid) 3.97662 12.322 28.0262 49
Laboratory of Theory of Biopolymers 2015