Project name: 2J6K unbound default 2 run A PPKPRPRR ss: CCCCCCCC

Status: done

submitted: 2015-02-25 18:46:56, status changed: 2015-03-13 11:02:37

Project settings
Protein sequence(s) VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK input pdb
Peptide sequence PPKPRPRR
Simulation mc cycles50
Peptide secondary structure CCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.6518 5.11957 24.3248 203
cluster_2.pdb ( medoid) 32.347 4.14258 20.8328 134
cluster_3.pdb ( medoid) 29.6613 5.19195 26.6909 154
cluster_4.pdb ( medoid) 20.7639 4.67158 23.6868 97
cluster_5.pdb ( medoid) 15.0695 5.37509 12.7493 81
cluster_6.pdb ( medoid) 11.2166 8.29128 21.2023 93
cluster_7.pdb ( medoid) 10.7466 5.02483 11.8568 54
cluster_8.pdb ( medoid) 9.47378 6.22771 25.3627 59
cluster_9.pdb ( medoid) 5.12259 15.0315 34.1491 77
cluster_10.pdb ( medoid) 4.58932 10.4591 21.6218 48
Laboratory of Theory of Biopolymers 2015