Project name: 5ed96599798a0fd

Status: done

submitted: 2018-07-12 10:40:23, status changed: 2018-07-26 03:47:45

Project settings
Protein sequence(s) MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR input pdb
Peptide sequence NTAGLVYQEAGVLKMSVHVHISKSKVGWLI
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEECCEEEEEEEEEECCCCCEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.8647 4.66524 28.8574 116
cluster_2.pdb ( medoid) 12.4805 17.5474 54.3794 219
cluster_3.pdb ( medoid) 10.8893 13.4077 48.9307 146
cluster_4.pdb ( medoid) 10.372 10.7983 31.1168 112
cluster_5.pdb ( medoid) 10.0925 7.62944 26.1434 77
cluster_6.pdb ( medoid) 9.3118 11.3834 53.9177 106
cluster_7.pdb ( medoid) 4.7544 15.1439 36.2936 72
cluster_8.pdb ( medoid) 4.11405 7.77821 15.0753 32
cluster_9.pdb ( medoid) 4.11337 17.2608 38.5863 71
cluster_10.pdb ( medoid) 3.87339 12.6504 32.0032 49

 
Laboratory of Theory of Biopolymers 2015