Project name: 60ce0c1618e3c51

Status: done

submitted: 2017-09-13 06:53:46, status changed: 2017-09-13 15:01:23

Project settings
Protein sequence(s) MHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDS input pdb
Peptide sequence SYSMEFHRWGKPVGKKRRPVKVYP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCCCCC
Flexible regions
Unlikely to bind regions
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.9893 4.91533 34.5533 113
cluster_2.pdb ( medoid) 17.2695 12.9708 43.8354 224
cluster_3.pdb ( medoid) 14.6999 7.95923 35.4142 117
cluster_4.pdb ( medoid) 10.725 7.8322 31.3611 84
cluster_5.pdb ( medoid) 8.36845 13.3836 56.4704 112
cluster_6.pdb ( medoid) 6.97625 18.9214 40.3473 132
cluster_7.pdb ( medoid) 4.41737 17.2048 47.0432 76
cluster_8.pdb ( medoid) 3.05982 22.5504 53.3218 69
cluster_9.pdb ( medoid) 2.65211 11.6888 32.6095 31
cluster_10.pdb ( medoid) 2.58713 15.8477 37.7999 41

 
Laboratory of Theory of Biopolymers 2015